CAZyme Information: MGYG000003252_01760

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_01760
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000003252_144|CGC1	43317.74	8.7299

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 42286; End: 43413 Strand: +

Full Sequence      

MKKKLFSFVALSIMSVCSWGQGLFSASEVKSVMKRVADWQIANPAKGAEHDDLSWTHATL
YMGMIDWAELTEKEDGDNSYYNWLRSIGKRNAWQVGRYMYHADFIAVGQVFIDMYHKYGD
RNMLLPTMARTEFVINHPSASTLKLDYRNMVTLERWSWCDALFMAPPVYAKMYMLTNDRK
YVDFMNQEYKATYNYLFDKEKQLFYRDHRYFGKKEANGERVFWGRGNGWVLGGLCEILQA
LPRNNMHREFYQDLFVRLSNRMASLQGEDGYWHASLLDPKSYPSPETSATGFIVYALAYG
VNEGLLDKEQMIPVIKKGWEALVKAVEKDGKLGYVQPIGADPKKVTREMTEVYGVGAFLL
AGNQMYKLVSTHLSK

Enzyme Prediction     

No EC number prediction in MGYG000003252_01760.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	367	6.1e-86	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.27e-97	32	368	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	8.97e-47	29	368	16	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58171.1	3.54e-237	3	369	2	368
QUT90811.1	7.13e-237	3	369	2	368
QDO70899.1	3.60e-230	3	368	2	367
ALJ59360.1	2.51e-200	3	368	2	368
QUT89583.1	2.51e-200	3	368	2	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	5.20e-75	23	368	23	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	2.49e-57	3	361	2	367	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	9.80e-49	65	361	65	350	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	7.43e-09	158	368	141	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.03e-08	158	368	131	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	1.78e-77	12	368	17	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	3.48e-74	23	368	30	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	6.78e-74	27	365	55	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	4.07e-08	158	368	141	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006186	0.405006	0.586515	0.000991	0.000626	0.000665

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_01760.