CAZyme Information: MGYG000003252_01446

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_01446
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
982	MGYG000003252_107|CGC1	112282.81	6.6669

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 9689; End: 12637 Strand: +

Full Sequence      

MLLLLLVTIGSRANNREKYNFNSQWLLHVGDIQGAEKNSFSDKDWKKVTLPHAFNEDEAF
KVGIENMTDTISWYRKHFKLPKTAKGKKVFIEFEGVRQGADFYVNGNHIGLHENGVMAVG
FDLTSYLNFGGENVIAVRTDNDWNYKERATGSRYQWNDKNFNVNYGGIPKNVWLHITDKL
YQTLPLYSNLQTTGVYVYATDIHTKSREAVINAESEIRNEYDTPFNVNYEVSVYDYDDKL
VSTFRGEPMVVSPKTTVTVKASQKLDNLHFWSWGYGYLYKVKTRLIVNDKIIDEVATRTG
FRKTRFGEGKIWLNDRVLQMKGYAQRTSNEWPGVGLSVPPWMSDFSNGLLLDHNANFFRW
MHVTPWKQDVESCDRVGVIQVMPAGDAEKDAVGRWWGQRVELMRDAIIYFRNNPSILFYE
SGNESISKEHMLEMIAIRDKYDPYGGRAMGSREMLDIREAEWGGEMLYINKSEHHPMFAT
EYCRDEGLRKYWDEYSYPFHKEGAGPLHRGQDASIYNHNQDMFAVELIRRWYDYWRERPG
TGRRVSSGGAKIIFSDTQTHRRGEENYRRSGVVDPLRIPKDGFFAHKVMWDGWVDTEKEH
TYIMGHWNYSPDVVKPVYVVSTGDKVELFVNGKSKGFGKQDYRFLFTFEKIQWEEGMIEA
VSYNEFGKELSRYSIKTVGEPERLKLTLIHGPEGLFADGADLAMVQVEVVDSNGNRCPLA
NNKISFDLQGPAEWRGGVAQAADNYVLAKALPVECGITRVLVRSTGKAGKITIKAEASGL
ISAEVSLTSIPVKVENGLSKFFPGEKLASRFDRGETPLSPSYKDSKVDVRVKSAIAGVNS
EEAINSFDSNELSEWKNDGRLSTAWITYQLERKAEIDDICIKLTGWRKRSYPLEVFADDE
LIWSGNTEQSLGYIHLPVKPVRSDKITIKLKGAAKEADAFKQIVEVVEPSAGDLDLLRAK
NGEKTNNELRIVEVEFLETLYK

Enzyme Prediction     

EC	3.2.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	13	547	5.1e-64	0.586436170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18565	Glyco_hydro2_C5	1.52e-23	695	786	10	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10150	PRK10150	3.47e-23	73	429	68	422	beta-D-glucuronidase; Provisional
COG3250	LacZ	4.26e-22	44	456	41	438	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	8.40e-16	74	443	113	468	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	4.45e-13	197	302	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCV07132.1	0.0	1	980	10	989
ALJ47734.1	0.0	1	980	10	989
QRQ54633.1	0.0	1	980	10	989
QGT72528.1	0.0	1	982	10	991
AND21860.1	0.0	3	980	12	990

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	4.16e-166	13	803	32	818	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
7CWD_A	8.23e-61	18	787	3	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	5.49e-60	6	787	14	818	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
6B6L_A	4.76e-56	11	788	1	776	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	6.65e-56	11	788	1	776	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	1.79e-165	13	803	23	809	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	2.29e-59	11	789	37	848	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	4.73e-54	2	730	31	758	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	1.15e-53	16	793	3	739	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	1.08e-35	14	733	49	773	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006355	0.992788	0.000215	0.000216	0.000193	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_01446.