CAZyme Information: MGYG000003252_00843

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_00843
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000003252_52|CGC5	45359.17	7.2351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 146952; End: 148151 Strand: +

Full Sequence      

MKKSRPTIGIVKSRMLLAGAAFVLMACSSGEEFTGYPGKGEEPVITPVLCTSGASEQAVK
VYDFLRENRNKKTLSGTMACPSWNVNEAEWVYQHTGKYPAIAFFDYLSLEYSPCSWIDYS
KTKIVEDWWNKNGLVGAGWHWRVPCVQGSAERHYTPGDGSVDPGTGKRTTTIFSAANATR
EGTWENEVVKADLKKLAGYLKLLRDKGIPVIWRPLHEAAGNIYNYKNGKAWFWWGNDGAE
AYKKLWIYIFNYFKKEGINNLIWVWTTQTKDSEFYPGDEYVDMVGRDMYPAKDESTTGEY
CFRQYGTITASCPGKLVALSECGNGEQSGKVYQLARISAQWEAGAKWTFFMPWYDYSRTK
EPDSEAFTATSHKYADKDWWVDAMSQDYVITRDQLPSFK

Enzyme Prediction     

No EC number prediction in MGYG000003252_00843.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	52	394	6.2e-81	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.08e-43	51	356	2	285	Glycosyl hydrolase family 26.
COG4124	ManB2	7.30e-13	183	289	154	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHW58761.1	1.77e-147	45	399	41	370
QGY44077.1	1.12e-145	25	399	110	461
QRQ58989.1	5.46e-119	28	399	23	360
SCV06948.1	5.46e-119	28	399	23	360
ALJ47537.1	5.46e-119	28	399	23	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	2.60e-120	28	399	23	360	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	1.32e-76	49	395	4	334	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	3.06e-72	49	395	95	425	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3WDQ_A	6.85e-57	51	398	36	355	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	1.42e-32	45	399	141	451	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55298	7.61e-35	39	398	146	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	1.06e-34	1	398	117	464	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P49425	3.00e-33	49	399	146	461	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55296	5.85e-33	1	398	116	463	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
G2Q4H7	6.31e-29	42	399	167	480	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000005	0.000084	0.999955	0.000001	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_00843.