CAZyme Information: MGYG000003247_00729

Basic Information

• Species: Borkfalkia sp900761675
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia; Borkfalkia sp900761675
• CAZyme ID: MGYG000003247_00729
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786	MGYG000003247_37|CGC1	88861.25	5.1882

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003247	1776245	MAG	United States	North America

• Gene Location: Start: 21242; End: 23602 Strand: -

Full Sequence      

MKKDCVTPQDRRCYGQKVIESEHVVAPENILLGKSCVFENKGGNCAGILLDMGECSVGGY
PVFTVKSFRGTAKLRIAYSDRFRSIEKAQKGRIYGDFVRGCCKYLGVELPVLPANPGRYE
LYSIARTGEYVFPLIQGQERFVLLMLEGEDAAVELEGFYIWYTSFSQPCVNEFDCDFTAL
KKLWYASANTLCIATLQSRQWDFLNGKLLLRALTKSNQAGMFRGVRAKDAFIFSYVFSIA
YNPDMPSGIGAFFGAQDKDNGYVLNLDLDGELSLYRRETGVNRLLERIFLPPLTDGVFYK
AEIRGEDEKIDFYLDGKLVFSYRGIRIGGGFGFCQTVEKWAVVSEIEIQEKGKTLFEDDF
SSPDFARYDIVTEDYFIADGAKRDRLPWSGDIDWAFRSGFYCYSFDTAMKNTLAIFARHQ
NPEGFVYGTCYPENHVRPPIGDYGMYESDMFSAWYLLSACTYYEYTGDTDCIKKLYPTLL
LGADYLAQYIDAEGVFCQRYQTSKGLWDHCLGDIGKNCYTNIIVQLCFARIARFAQELND
PENASRLLKVAEHMKKGIYKTFWRQGGFIKSEKIEVFCDMANSIALAYDFVTAEEAGEMV
NSFLSRDFEQVAHGKTLVLTMRGLFHYGYDELAYKLLTGKTRVEAAKNFFLTVDWLGITE
TDAYPHTTAECQHFPPAHSAEPDNWGDMSHPDTAVCELISGCILGIRPLATGFKKVLIRP
NLHGMKRMKGSLLTKYGKIGLEVVNEDGTTTVRYSVPKNTEAVFDFSKLGENVISEEMSG
ENGFEL

Enzyme Prediction     

No EC number prediction in MGYG000003247_00729.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	377	763	5.7e-49	0.7202380952380952

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.58e-12	379	642	34	294	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	1.42e-07	405	588	302	491	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17390	Bac_rhamnosid_C	3.23e-07	705	762	1	59	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH42040.1	3.91e-163	2	768	5	765
QJD86808.1	5.00e-157	41	768	56	774
ACU72642.1	2.03e-29	41	748	98	806
QJD84299.1	1.00e-19	305	778	218	678
ALJ01625.1	2.30e-18	306	755	260	695

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.18e-11	370	739	324	672	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003247_00729.