CAZyme Information: MGYG000003246_00013

Basic Information

• Species: Borkfalkia sp900761665
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia; Borkfalkia sp900761665
• CAZyme ID: MGYG000003246_00013
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
726		80363.15	6.3105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003246	1581010	MAG	United States	North America

• Gene Location: Start: 15797; End: 17977 Strand: +

Full Sequence      

MLKGCFVGVRENADTFVLEKTFRAPAAKKAVLRATAPGTYFAEINGVRVGDAYLALGWTT
YGKTLQVQEYDVTALLREGENTLSFTVNEGWYCGPLTWQGKRALYGEKPAVCADLYADGK
LLLSSSEEWSARESFIRKSGIYDGETQDFTAECAALTPCAVAFDKKVLVPQICEPVRTTQ
RLPVREVIRTPKGELVYDFGQNLAGVAEIRTPEGFSGTVTLQFAEVLVGGNFYTANLRSA
KATDSFTVKGAAVLSPEFTFHGFRYMKMEGAELPAENVTALVRHTDMRRIGRIWVDDARF
RRLLDNVVWGQRSNFVDIPSDCPQRDERLGWTGDINAFCRTAAYNYDVRAFLKKWLKTVR
DDQRKTGEIAYVSPDVLGWNGTDAMWCDAVSMVPWTLYEMYGDLSFLSENFGAMKKFIAA
RERNMENGLVARGHEFGDWLALDNEEFVGNGVYGRTDSFFLTNALHANTLKIAAETARLL
GDGAAEKRYRGKYAAHLKRMRREYFTAGGRLAFDTVTAQAVALHFGIVPEEHRAKLARAL
GENVRRHGYRVTTGFIGSSFLLYALADNGCFDAACKLLLNEKFPGWLYEVDMGATTIWER
WNSLLPDGTPNPDGMNSYNHYAYGSMMEFVYSRIAGIGAAAPGFAKIRIAPHFCEGLNKV
RAEYESVHGRIAAGYEAADGKIVYTAEIPEGAEAEIELPGEAPVCAGGGVYTFERPLPAA
GDAPKS

Enzyme Prediction     

EC	3.2.1.40	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	188	698	1.1e-154	0.996031746031746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.00e-118	288	634	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.04e-39	28	180	4	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.18e-23	188	284	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.98e-16	636	709	1	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLG40468.1	2.77e-176	28	714	138	832
QYH55287.1	3.98e-175	29	725	139	847
QRT30265.1	4.32e-172	15	714	131	831
QRT50983.1	1.21e-165	30	714	140	836
CCI70403.1	3.69e-165	28	700	153	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	8.41e-136	18	703	305	999	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	6.38e-125	30	713	147	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	4.21e-80	28	699	190	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	3.45e-135	18	703	305	999	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	7.84e-121	30	699	190	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	7.83e-111	29	706	185	886	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.16e-52	38	698	208	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003246_00013.