CAZyme Information: MGYG000003237_02332

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_02332
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866		95000.35	8.0703

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 77213; End: 79813 Strand: -

Full Sequence      

MKTMLFAAAALGGALLSAAPVIEKLDYPETVRAGEPFALSVTVSGTGDAPASCSFNGETR
LIPPNLHNYAAGKLAAKYSKIEADGAVTAGSDYHTLLSFPLPQDGRSYTVWVRASGGALC
LRRPEKELKWSFGRSGTFRWINFGSWNRAQAGPTLALMSEKTPYARVERILLTTAPAAAY
RPAGDGSAPNRFVWVPGVSAVGRHRFEVTVSAGGESAKRTVEVTVLPPARETGTPVPAAA
AASGGQRRLDLAKLSVRAADYPLFDFFGKECREALEKKPFGLSFAPGNMIALRCNAFPSL
PDTVEIPVGAKAAGIALLLAEYWQGDVMQEMAHIRVRYADGTEVRIPLREEFELCGSFRN
REPQAALYVGTFSSGQAEFHLTVLPWVNPHPGKEIASLAFSNIRMVVSKEENKLIPLNVT
AESSQLLLGALLLERSADAGNLAAAAGKKCETHSGTVEVTVDFSSPAGKIHPNVFSTNET
DVQSADNPKFDEYLEKMKSVGCRLYRFHSGWNLESVYPDKLRNPQYEKLALTISKLKSAN
PEWDVMICFNKIPSYVNPKTPEGRRLFASLCADLVRELNLKRKFDLRYWEIYNEVYFKKI
EEDRSLWKMYNEAAAAMRKVDPSIRIGGYAPCWPSVGAIRDFYRHCGEETDFISYHKYLT
GSVKTPTAYLMAGTASFGEDARAIRAMAEEERPGRPVELALTEYNINFNWKPHDPRQANR
IGAAWFASVLHHLVKADVEIAQTWHSRGGGTFGLFSADNEPRPAAAVFAVANRYLKGEYL
KSATSSPEVECLAFRNPERRGLLLVNKSDREVTVTLDLLNLPPAPETVLPSVESVGISGG
SVSSEKLPAIPEEVVLKPYGVYLLAW

Enzyme Prediction     

No EC number prediction in MGYG000003237_02332.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	567	805	6.9e-17	0.5893271461716937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd21510	agarase_cat	6.11e-12	587	658	100	187	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.
pfam01229	Glyco_hydro_39	2.33e-11	573	828	129	417	Glycosyl hydrolases family 39.
COG3534	AbfA	2.94e-05	572	796	151	402	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44834.1	0.0	1	866	1	866
AFY34779.1	1.20e-54	458	847	35	430
BAZ63320.1	1.30e-52	451	864	31	446
BAZ17175.1	1.30e-52	451	864	31	446
AFZ16490.1	2.49e-52	448	864	43	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1W91_A	4.37e-09	585	772	149	356	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	4.37e-09	585	772	149	356	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2BFG_A	5.76e-09	589	772	158	356	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23552	2.72e-10	557	825	123	396	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
Q9ZFM2	3.16e-08	585	772	149	358	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000686	0.998550	0.000214	0.000186	0.000172	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_02332.