CAZyme Information: MGYG000003237_02054

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_02054
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
818		89199.36	6.4171

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 46655; End: 49111 Strand: +

Full Sequence      

MKLFTLVFAALAALLSVPAPAAELMKLDIDFGHPAWRGVVTPLWGGLPEVERNGNTAALA
FGPGSFCGTPLIPCPPGSVVEIAFDASATAIAPGGEAWRTAAVQLGLFDGTAEQSHLDLF
NTGRATPFRRYESRTPVSGNGFRLCFGNYGRSGTFRIANLSIRIMVPGRNVERDGSFSGM
FGINDWFVQKGGVDWDGLGLGSFEHAKVVKNAFPGTGSTLELDGGATVVSRQFPYSGEGL
VVGGWFRQAGIARPEDGRPWAHAGIQLVFFDRDDNVIGHDDVTRQLLPGDRPWGYHVIEI
SPGGLSPKVKSVALYLRIWGGTAGKAWFDELAVVKQGEGQARNYDSSKGVIAVGPAGEEA
AELVRVWNGVDLSYCSQIDLPQVRTALRRLKEEGGLEYLRTREFFNGPFPVKSIDAAGNM
TYDFSTVDKYLDYPVKELGLKLVPTIETVPPQLRRDSGGHVPKDFALWGRAVKALVRHWI
GRYGREEVSQWVFECWNEPGSDFFRGTDEEFCRLFVAYLEALTGVEKECGIKLRIGTPSG
AMNNLLSRAMEAARRAGLDGAVTDASTHIYGGFAGAMELYRIGIEDVRKRMEPFPAGRGV
PVHVTEFNGSAMGSRHFDTQTGAAFVVKANRLMADEGVLRTYFYCAIDHPYLNLEHHYST
DLGYMTHYDAVPKPSFNALVLLNRLEGKRLPVKASSEPFDAMAAVAGDGTMRIVVTTFSE
EELGAAKPVPVTLEIDWAGRPEKLGRAELVRIDSAHANSYAAFEKAGKPSYRENPDTAAY
REAAKLVPEALQTYRFENGKLIIPLVLELNSVAAVTVK

Enzyme Prediction     

No EC number prediction in MGYG000003237_02054.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	383	771	1e-48	0.9350348027842227

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	5.73e-36	384	817	36	487	Glycosyl hydrolases family 39.
COG3664	XynB	0.002	382	502	5	117	Beta-xylosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44872.1	0.0	1	818	107	924
AVM45825.1	3.33e-141	1	817	2	800
BBL77251.1	5.69e-30	357	816	9	474
QPC92966.1	6.32e-28	387	815	41	473
QYN52652.1	5.58e-27	387	801	39	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1W91_A	8.23e-15	387	818	39	481	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	1.09e-14	387	818	39	481	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2BFG_A	5.85e-14	387	818	39	481	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
1PX8_A	3.11e-13	387	539	39	199	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]
6UQJ_A	3.18e-13	392	710	57	384	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23552	4.95e-26	384	818	42	486	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
Q9ZFM2	5.63e-13	387	818	39	482	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P36906	1.70e-12	387	539	39	199	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
O30360	3.94e-12	387	539	39	199	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000210	0.999173	0.000147	0.000152	0.000137	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_02054.