CAZyme Information: MGYG000003237_01803

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_01803
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920	MGYG000003237_52|CGC1	103293.53	8.0733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 37109; End: 39871 Strand: +

Full Sequence      

MSDVMRTALFGCLLAAAFSAAGIEIRGANFANWFVAGEPVLFRAKETLPESAQVAVAVFD
SAGKEAARQEFSGAVFNREGWRWNAPRPGFYEAEFKVDGETVSEHYPVGIRRQDPVDKRK
YTFVGKRDFAVSRHAFAVAPAKTADPADISPHFGASPHFSMYKNAIPLARLIGFHSIRIH
ALRWDSMEKEPGKINWSGVDDFLRLARENGFPDERITFNIYGTPRWASSRPEADWINIFV
PEYAAVTPKNLDDWRNFIRQVMRRYPKIGRYELWNEPHLIGFTCFWVDSTRNFVDLLKAG
YETVKAEKPEATVWLGGIGMRYLPFYDEFLKLGGGRYYDVLPLHGSWVRPEPFHELEKKY
GLEPKPVVSSEWHAMLLKPYAQDFPSEQLLARNMVLDFLNQIRAGVTEVDFFCILNLYRT
EKETLQFHRENRSYDTHVSGLFRQVPYIQPRYPALAWQVFTAQVKGKLKVGSGYLFDNNT
QRALMLESDSGPMLMVWNTGGKAAPAAPELRSAVGPDSRILTAEGAELERGAPLTLEPEV
YYFVRDPDPAAVAAWRNTGEVLYAQNAKLTLQNKLNGVYRRGALFDADMNPVFPQKIAWQ
PVAERVVNNPALAPGETKGRFAAGFTSAGLELLVEVEDPVHVMKADNGKVWEFDSLQFAL
DTKGEGFDVDRIEFAAALGEDGKPVLWKVYAPNLAGDLPARYTPAGERVRNGRCRIERKD
GRTVYRIAVDASELYPFSLEQQPRVRFSLLVNNNDGKGRAAWIEWGSGIGGVKDPCRYGN
LTPALPPGPLASQQQLKNKGWNKEYELEFRNENGIPSVKVGSSPLCAGVSSGWFGVVPGA
VYRVRFEARGDARLQVLASGSAVKRLDLLPPTPLGAGWEAFDLPLYVPTECRGLSVTCFA
WRQPGRTFEIRNFTVEPFRQ

Enzyme Prediction     

No EC number prediction in MGYG000003237_01803.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	170	437	4.1e-24	0.5730858468677494

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.79e-29	630	782	41	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
pfam01229	Glyco_hydro_39	3.05e-08	172	330	46	208	Glycosyl hydrolases family 39.
cd00241	DOMON_like	6.39e-07	610	765	11	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
smart00633	Glyco_10	2.23e-05	182	277	1	86	Glycosyl hydrolase family 10.
COG3693	XynA	0.009	181	277	66	151	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45582.1	0.0	1	920	1	920
AVM45605.1	7.37e-143	24	784	346	1094
BBH20281.1	1.10e-128	25	802	216	997
BBH24554.1	8.08e-127	23	781	375	1135
AHF94113.1	3.57e-114	33	789	231	990

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001890	0.997056	0.000411	0.000206	0.000200	0.000207

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_01803.