CAZyme Information: MGYG000003237_01213

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_01213
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000003237_33|CGC1	43402.87	9.0441

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 98321; End: 99496 Strand: -

Full Sequence      

MNVKRSIWIISGEASGDVYGAKLAAELRRLAAERGDKLTVSGMGGPKMIAAGIDIRVDST
ELGVVGVIEVLKHIFTFIGIFFRLVGQAKKERPGAVVLIDYPGFNLLFALMMYWNKIPVV
WYVCPHLWVWGKWRLPVLAKICTKMLVIFPFETEVFAPTRLETEFVGHPLVDIVEERRNP
EIVRDPASFLLLPGSRTMEINFLLDPMLGTVAELAKKHPALKFHIAAPREKIARLCREKY
ARYREKHPGTPEVGISCGDTSDWQQRAGTGLAASGTVTVESAIAGLPLVVGYKLNWVTIL
LASLVVRLYRGFFTMVNIIANREVYQEFLQHHFTPKELVPAVEAILPGGARRAEVETGMA
EVKQLLTPNSSSAGRQAAEACYGVLEEQPPR

Enzyme Prediction     

No EC number prediction in MGYG000003237_01213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	366	2.4e-91	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.22e-93	7	386	4	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.83e-89	7	387	4	378	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.41e-68	7	380	1	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.97e-60	1	366	1	365	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.00e-36	57	341	43	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45461.1	3.43e-285	1	391	8	398
QSH40861.1	1.39e-166	1	382	1	383
QUE51553.1	4.08e-66	7	380	5	369
QHI67954.1	9.23e-64	3	379	1	369
ABF41536.1	1.03e-60	7	388	4	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	8.12e-32	6	380	8	376	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.55e-31	6	380	8	376	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1INL4	2.06e-61	7	388	4	381	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q02AZ6	1.16e-55	7	388	4	376	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q2IL69	5.79e-52	7	385	11	382	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	2.23e-51	7	385	11	382	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	3.13e-51	7	385	11	382	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_01213.