CAZyme Information: MGYG000003237_00348

Basic Information

• Species: Victivallis sp002998355
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis sp002998355
• CAZyme ID: MGYG000003237_00348
• CAZy Family: GH163
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751	MGYG000003237_12|CGC1	85502.73	8.2752

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003237	4618450	MAG	United States	North America

• Gene Location: Start: 882; End: 3137 Strand: +

Full Sequence      

MKWKLMILPALLLPVLATAAPKLVENGRSDYAIVLPQSATLPEETAAKELQSMLKRISGA
ELPIVRDETYAGKAILLGRSDRTAQLLGVDFRELRPDEILLKQCGDDLVLSGDRPRGTLY
AVYEFLEELGVRRWTFRDEEIPHLATIGLPPRDCRYAPPFEGRDRLGGTNGTYGAWMRVN
GHYLNVPESHGGVIRLIGWCHTLGEMIPPREFAKSHPEYFAEVDGKRGVWDDRNGFPQLC
LSNPEVRRILREKTLERLRSEKNSRIISVSQNDSWGAMAENYCRCEKCAALDQAEGSPMA
SVLSVVNEVADAVKKEFPGVLVETIAYHYTRRPPATLRPRENVIIRFCTRNNFLYPWDSG
ENAAGRDEFLAWSRIAPKLYVWNYTANFGNTMMPHPSLRNYAADLRFMAANNVIAVLEQG
YGRGLTGDLLPLHNYLLCKLMWNPQLDQEKLTDEFLTGYYGAAAPAVREYMDASWELFRR
RALKLGGSMIEKEALPLADLLELKRIFDRAEQLVQSDPARLLRVRTAAMVVDLPILHSAE
AAYENRETPAGRELRSRLDLPALVRKTAETYRKLDCRDFYRENGRLSIDSYIDTAAKRVT
GDWSGGRPAPDICRDVRPEDWRRFGPESFVSWECTRKQEDGATVLEFPTRKNNWLVHWNY
RPEFGLDGEWRVFVALRTETAVRNGNALMIGSSGFGQRPVRIDECRGKQFRWIDFGVRNF
KGGGRLVFAPSGIDQKLEIREIVLVRENRSK

Enzyme Prediction     

No EC number prediction in MGYG000003237_00348.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH163	206	471	2e-82	0.9960159362549801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16126	DUF4838	7.41e-93	199	471	1	263	Domain of unknown function (DUF4838). This family consists of several uncharacterized proteins found in various Bacteroides and Chloroflexus species. The function of this family is unknown.
pfam03648	Glyco_hydro_67N	3.04e-05	22	124	7	119	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
cd14791	GH36	0.003	205	323	88	195	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44733.1	0.0	1	751	9	759
ASV73444.1	3.53e-95	3	542	6	550
QQL44163.1	1.32e-93	29	538	19	528
AIE83908.1	8.63e-93	29	472	19	452
AIF26900.1	1.78e-86	23	479	6	484

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000727	0.998027	0.000528	0.000215	0.000237	0.000251

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003237_00348.