CAZyme Information: MGYG000003224_02121

Basic Information

• Species: SFFH01 sp900542445
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; SFFH01; SFFH01 sp900542445
• CAZyme ID: MGYG000003224_02121
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254	MGYG000003224_47|CGC1	30008.43	4.188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003224	2769713	MAG	United States	North America

• Gene Location: Start: 8069; End: 8833 Strand: -

Full Sequence      

MKANQAKEFEKNDYGVFLNADTSSLERFKMYETIVIDAQYFTKRDIELLHQNGIVVYTYL
NIGSIENFREYYTTYAELAIGEYEHWEEEEWVDVANPDWQKFIGQLSQELYEKGVDGFFI
DNCDVYDYDPHERIFEGITAILQNMMTFGKAVIINGGDTYVAEYRERYGAIDQIMTGVNQ
ESVWSSIDFDSGTFREQTSETRDYFCKYLEMCKADGVEVYLLEYTTNQKLIQKIKEYCKE
QNFHFYISSSLELR

Enzyme Prediction     

No EC number prediction in MGYG000003224_02121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	33	249	1.2e-56	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3868	COG3868	3.45e-12	31	251	80	301	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
pfam03537	Glyco_hydro_114	2.01e-08	35	134	21	120	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG2342	COG2342	5.17e-08	11	224	25	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	0.001	92	165	120	191	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08521.1	1.83e-103	10	253	39	282
VCV23723.1	3.68e-103	10	253	39	282
CBL11057.1	3.68e-103	10	253	39	282
AOZ95737.1	3.43e-87	10	254	41	286
QHI71547.1	7.66e-83	8	253	26	271

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000099	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003224_02121.