CAZyme Information: MGYG000003221_02870

Basic Information

• Species: OM05-12 sp900760755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp900760755
• CAZyme ID: MGYG000003221_02870
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
806	MGYG000003221_57|CGC1	90804.46	6.7644

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003221	3509168	MAG	United States	North America

• Gene Location: Start: 56411; End: 58831 Strand: -

Full Sequence      

MKYSIASLTVAGLFLGNAAAQQKPNIILFLVDDMGWQDTSLPFWKDTTSLNRIYETPNME
RLAQMGVKFTNAYACSISSPSRVSLFTGANATQHKVTNWTLKKNMPTDRKDNVLEFETWN
YNGLSPEPGLEHAFYAKCLPQLLRENGYTTMMVGKAHFGSLDTPAADPLTIGFDYNIAGH
AAGAMGSYLGEEGYGATGKPEWAAIWAVPDLEKYHGTDTFLTEALTLEAKGLMDKVLAKS
KPFFLYMSHYAVHAPFKTDKRFYQKYIDKGLSHKEAQYAALLEGMDKSLGDLMDYVTQKG
IADNTVIIFMSDNGGYTIGRTDKNFPLSEGKGSLKEGGIREPMIVYYPNVTKPSTVNHTP
VIIEDFYPTILELAGVSAYQTPQQIDGKSFVSQIKGQAGDKERALFFHYPNNWGERVHTI
GAPQSAIVKGDWKLIHYYVTGSNSLYNLKDDISEKNDLSVRYPDKTKELAKELSDYLRAQ
HATMPILKATGTFVPYPDGGQVDRKLPKDDETLVYEDPAGILSLKVGDKHPRVAGWHFYT
AHEFNDKDTKKGLSLGFVEHRGKHMSRTAKVDNKKCSGVEDGILHIWSVEEKDSIDNRYG
NKVKYSTGCYKTPAPGDKNFWCRFTENMRIEIRFKRTDTQGFNDALWFMGNNNRPWPKNG
EIDLLENPKKRVNQTAHFTLHSENHYAGVVGGEGSVTSNITLADMTQWNIYWMEWYPDRI
VGGVNGQQFFEHVKGANGNQDWPWSDPAGFFLIFSTGISVNPNAWPGEIIPSEWDKQNPP
SMFIDWVRVYTNENYRGEPAPQVKFY

Enzyme Prediction     

No EC number prediction in MGYG000003221_02870.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	571	790	3.9e-28	0.8565217391304348

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16144	ARS_like	4.65e-172	24	476	1	421	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16146	ARS_like	2.53e-86	24	476	1	404	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16026	GALNS_like	2.18e-77	23	459	1	399	galactosamine-6-sulfatase; also known as N-acetylgalactosamine-6-sulfatase (GALNS). Lysosomal galactosamine-6-sulfatase removes sulfate groups from a terminal N-acetylgalactosamine-6-sulfate (or galactose-6-sulfate) in mucopolysaccharides such as keratan sulfate and chondroitin-6-sulfate. Defects in GALNS lead to accumulation of substrates, resulting in the development of the lysosomal storage disease mucopolysaccharidosis IV A.
cd16145	ARS_like	1.24e-76	24	463	1	415	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16031	G6S_like	1.67e-75	22	473	1	426	unchracterized sulfatase homologous to glucosamine (N-acetyl)-6-sulfatase(G6S, GNS). N-acetylglucosamine-6-sulfatase also known as glucosamine (N-acetyl)-6-sulfatase hydrolyzes of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate. Deficiency of N-acetylglucosamine-6-sulfatase results in the disease of Sanfilippo Syndrome type IIId or Mucopolysaccharidosis III (MPS-III), a rare autosomal recessive lysosomal storage disease.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89376.1	0.0	1	806	1	806
ALJ59588.1	0.0	1	806	1	806
EAR02039.1	1.69e-171	21	497	26	508
QBJ17909.1	9.80e-150	508	806	627	925
AKJ65363.1	2.41e-62	5	485	6	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6USS_A	1.28e-180	23	498	33	515	ChainA, Sulfatase [Bacteroides fragilis CAG:558],6USS_B Chain B, Sulfatase [Bacteroides fragilis CAG:558]
6UST_A	1.35e-60	23	485	4	461	ChainA, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_B Chain B, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_C Chain C, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_D Chain D, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi]
7STT_A	4.94e-59	22	487	5	443	ChainA, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STU_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STV_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis]
6PSM_A	3.30e-48	11	476	12	436	Crystalstructure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_B Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_C Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_D Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_E Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_F Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSO_A Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea],6PSO_B Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea]
6PRM_A	1.57e-47	11	476	12	436	Crystalstructure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_B Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_C Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_D Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ9	6.92e-50	20	504	31	550	Sulfatase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22020 PE=3 SV=1
Q571E4	9.35e-33	8	411	12	386	N-acetylgalactosamine-6-sulfatase OS=Mus musculus OX=10090 GN=Galns PE=1 SV=2
Q32KJ8	1.27e-31	17	478	40	497	Arylsulfatase I OS=Rattus norvegicus OX=10116 GN=Arsi PE=2 SV=1
Q32KH5	2.43e-31	8	408	16	385	N-acetylgalactosamine-6-sulfatase OS=Canis lupus familiaris OX=9615 GN=GALNS PE=2 SV=1
Q5FYB1	1.67e-30	17	478	40	497	Arylsulfatase I OS=Homo sapiens OX=9606 GN=ARSI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000321	0.998945	0.000186	0.000190	0.000170	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003221_02870.