CAZyme Information: MGYG000003221_01685

Basic Information

• Species: OM05-12 sp900760755
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp900760755
• CAZyme ID: MGYG000003221_01685
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200	MGYG000003221_32|CGC4	23396.69	9.5218

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003221	3509168	MAG	United States	North America

• Gene Location: Start: 138319; End: 138921 Strand: +

Full Sequence      

MKRFLLLSVISLLISGLSGQDYRDKKNYKSWVKLAPKFDDAFLETPEARRIGDNVLLYQQ
TTGAWSKNIYMPAELTDNEKKKVIASKNKVNESTIDNNATTTEIEYLSRLYQATQDDRYK
EAVIRGIEYLLEAQYDNGGWPQFYPRPKGYYIQITYNDNTMVRVMNQLRRIYEKQAPYSF
IAEGICTKAKKHSTKEWIVF

Enzyme Prediction     

No EC number prediction in MGYG000003221_01685.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	59	194	2.6e-47	0.4652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	5.54e-64	59	195	1	139	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	2.21e-58	59	195	1	141	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
TIGR01787	squalene_cyclas	0.004	121	159	567	609	squalene/oxidosqualene cyclases. This family of enzymes catalyzes the cyclization of the triterpenes squalene or 2-3-oxidosqualene to a variety of products including hopene, lanosterol, cycloartenol, amyrin, lupeol, and isomultiflorenol.
cd04791	LanC_SerThrkinase	0.010	106	151	151	197	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK66206.1	7.85e-89	4	195	7	198
QQR16499.1	7.85e-89	4	195	7	198
ANU58592.1	7.85e-89	4	195	7	198
QUT25428.1	1.11e-88	4	195	7	198
QQA09409.1	1.11e-88	15	191	15	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	7.49e-21	41	189	76	243	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	6.13e-17	53	178	38	154	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	7.82e-16	53	178	38	154	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000614	0.554414	0.444427	0.000185	0.000183	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003221_01685.