CAZyme Information: MGYG000003217_00138

Basic Information

• Species: CAG-267 sp001917135
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-267; CAG-267 sp001917135
• CAZyme ID: MGYG000003217_00138
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	MGYG000003217_2|CGC1	91012.64	9.7158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003217	1875436	MAG	United States	North America

• Gene Location: Start: 135001; End: 137469 Strand: -

Full Sequence      

MTASEDIDNLVIVPPEKPLKMRAQPIMPPRVKRMWQKLWLKPREDRREADRGRNGAGARE
HAGSGAGDGRNRPVLRPWYGAEYAMLVHRRRRLLSTLVIVTVALGLLKWAAAMPSDITVW
TRAAVIVLFVLTFGWIALYFWSSILGFSQLLKRARMPGITYPADVEAALDAEAGIAADDL
RARQNPAAPKVREMASFIKAKTAVLMPIYNEEPAQVMARLLAIGEDLQQAGAGGRFDIFV
LSDTTNPKIWVKEEKIWLEAKRILESGSFGAESGELRESVAGAVEHGVRASGAESRSDTE
ATGRSGGTAGGAGLHIYYRRRAQNTARKSGNIEDFCNRWGAEYDFMLVLDADSLMTAETI
VKMARLMEANPHAGIIQASPQMVNSTSMFARMQQFAGKVAGPVVGAGLAYWQAGNSNYWG
HNAIIRTRAFIDCCGLPKLKGKGPFGGFILSHDFVEAALIARGGWSAWLLPELKGSYEEC
PPSMIDFAARDRRWCQGNLQHIKVLISRGLHPVSRVHFLTGIMSYLSSPLWLLFLLAGLS
MVLFREFIPPQYFGQTYSLFPNWPVFDKYGTIGLFVLSMAMLLVPKFLGLAAYLKGNAGK
NGRTDGVCGYVRSAWNAGKSLGLEIVVSTLMAPVMMLFQSKFVFDILRGKSVGWNAQNRG
DEGTSWQTAWQIHKWHTVLGAVTALVVWKYAHVLFWWLLPITLGLVLAVPLSVISSRVSA
GRWLRERGWFVIPEEICEPKVLARAKYWAGILAPFEAGNGGLAMLQNDRTLRMLHCRMLP
VNGPAPEFAPEVAETADAKLADGRLDDLTRDEEMWALYERAC

Enzyme Prediction     

No EC number prediction in MGYG000003217_00138.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2943	MdoH	0.0	8	820	23	718	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
PRK05454	PRK05454	0.0	4	730	1	599	glucans biosynthesis glucosyltransferase MdoH.
cd04191	Glucan_BSP_MdoH	1.03e-138	202	501	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
cd06423	CESA_like	4.94e-12	295	435	36	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06421	CESA_CelA_like	2.17e-10	203	502	4	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO00644.1	2.71e-182	128	819	52	659
ADO71363.1	7.76e-177	128	821	52	661
AFE09379.1	5.92e-173	128	819	52	658
AKQ67748.1	1.83e-172	90	819	14	660
QDE89328.1	2.59e-172	122	819	46	660

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8EF78	8.05e-154	128	779	94	657	Glucans biosynthesis glucosyltransferase H OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=opgH PE=3 SV=1
A1RJC2	4.47e-153	125	779	91	657	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain W3-18-1) OX=351745 GN=opgH PE=3 SV=1
Q0HUS0	4.47e-153	126	779	92	657	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain MR-7) OX=60481 GN=opgH PE=3 SV=1
Q0HJ63	4.47e-153	126	779	92	657	Glucans biosynthesis glucosyltransferase H OS=Shewanella sp. (strain MR-4) OX=60480 GN=opgH PE=3 SV=1
A4Y768	4.47e-153	125	779	91	657	Glucans biosynthesis glucosyltransferase H OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) OX=319224 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
93	113
123	145
522	544
572	594
615	637
693	715