CAZyme Information: MGYG000003208_04469

Basic Information

• Species: Pseudomonas_E extremaustralis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E extremaustralis
• CAZyme ID: MGYG000003208_04469
• CAZy Family: CE16
• CAZyme Description: Thermolabile hemolysin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	MGYG000003208_76|CGC1	32848.1	6.5676

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003208	6254364	MAG	United States	North America

• Gene Location: Start: 2980; End: 3885 Strand: +

Full Sequence      

MIRRACLAALLTLSVSTAFGATPYDHLYAFGDSYSDNGAGDMLTARLVAQQVKDAQVLPG
PLYWKGRWSNGQTAVEGLAKALKVPLTDYAVGGAKSGHGNYYAWMMPSRDTGVLGQIAEY
LQTAVSHRADPKALYFIFISANDFFEWADFSHPESIEALSTSSLANIRNAVEQLAAAGAR
QVMVVGTTDLSHVPAVVQGRQVANANQYQQLLAQNLPVVLAQLHGVNVRYFDHLAFSDAL
RADPAAHGFKDLDTPCQATYPDVKPVCTDPDAHYYWDEWHPTRKVHALAARAMLETLNAR
P

Enzyme Prediction     

No EC number prediction in MGYG000003208_04469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	27	293	1.5e-18	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01846	fatty_acyltransferase_like	1.05e-72	26	296	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
COG3240	COG3240	5.20e-46	5	299	10	335	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
cd01837	SGNH_plant_lipase_like	1.89e-26	27	294	3	312	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
cd01847	Triacylglycerol_lipase_like	4.56e-20	27	294	4	278	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
pfam00657	Lipase_GDSL	2.36e-12	27	293	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV39036.1	1.49e-181	1	297	1	297
AUB38401.1	1.34e-61	8	298	39	337
ARO87639.1	3.84e-27	20	292	23	319
CDZ97456.1	3.60e-22	24	297	79	353
QDL06570.1	2.07e-21	11	300	13	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UQV_A	8.91e-99	23	293	8	281	Crystalstructure of ChoE, a bacterial acetylcholinesterase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],6UQW_A Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQW_B Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQX_A Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1],6UQX_B Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1]
6UR1_A	2.54e-98	23	293	8	281	Crystalstructure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1],6UR1_B Crystal structure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1]
6UQZ_A	5.10e-98	23	293	8	281	Crystalstructure of ChoE D285N mutant in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQZ_B Crystal structure of ChoE D285N mutant in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1]
6UQY_A	1.02e-97	23	293	8	281	Crystalstructure of ChoE H288N mutant in complex with acetylthiocholine [Pseudomonas aeruginosa PAO1],6UQY_B Crystal structure of ChoE H288N mutant in complex with acetylthiocholine [Pseudomonas aeruginosa PAO1]
6UR0_A	2.92e-97	23	293	8	281	Crystalstructure of ChoE D285N mutant acyl-enzyme [Pseudomonas aeruginosa PAO1],6UR0_B Crystal structure of ChoE D285N mutant acyl-enzyme [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99289	3.07e-11	29	298	149	411	Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=VPA0226 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000319	0.998903	0.000200	0.000198	0.000191	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003208_04469.