CAZyme Information: MGYG000003208_02533

Basic Information

• Species: Pseudomonas_E extremaustralis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E extremaustralis
• CAZyme ID: MGYG000003208_02533
• CAZy Family: GT4
• CAZyme Description: Glutamate/aspartate import solute-binding protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000003208_37|CGC1	33507.45	8.4082

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003208	6254364	MAG	United States	North America

• Gene Location: Start: 419804; End: 420730 Strand: +

Full Sequence      

MRIVPHILGAAIAAALISTPVFAAELTGTLKKINDSGTITLGHRDSSIPFSYIADGSGKP
VGYSHDIQLAIVEALKKDLNKPDLKAKYNLVTSQTRIPLVQNGTVDIECGSTTNNAERAQ
QVAFTTNIFEIGTRLLVKKDKDGKPSYSDFADLKGKNVVTTAGTTSERIIKAMNADKQMG
MNVISAKDHGESFQMLESGRAVAFMMDDALLAGEEAKAKKPDDWVITGTPQSFEAYACMV
RKDDPAFKKAVDDAIVGLYKSGEINKIYSRWFESPIPPKNLNLNFPMSDKVKELIKNPSD
KPAPEVKI

Enzyme Prediction     

No EC number prediction in MGYG000003208_02533.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10797	PRK10797	8.52e-145	23	301	26	299	glutamate and aspartate transporter subunit; Provisional
cd13688	PBP2_GltI_DEBP	4.01e-108	30	272	1	238	Substrate-binding domain of ABC aspartate-glutamate transporter; the type 2 periplasmic binding protein fold. This subfamily represents the periplasmic-binding protein component of ABC transporter specific for carboxylic amino acids, including GtlI from Escherichia coli. The aspartate-glutamate binding domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
cd01000	PBP2_Cys_DEBP_like	3.55e-71	30	272	1	228	Substrate-binding domain of cysteine- and aspartate/glutamate-binding proteins; the type 2 periplasmic-binding protein fold. This family comprises of the periplasmic-binding protein component of ABC transporters specific for cysteine and carboxylic amino acids, as well as their closely related proteins. The cysteine and aspartate-glutamate binding domains belong to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
cd13689	PBP2_BsGlnH	1.71e-64	30	272	1	228	Substrate binding domain of ABC glutamine transporter from Bacillus subtilis; the type 2 periplasmic-bindig protein fold. This group includes periplasmic glutamine-binding domain GlnP from Bacillus subtilis and its related proteins. The GlnP domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.
pfam00497	SBP_bac_3	5.33e-62	39	272	1	223	Bacterial extracellular solute-binding proteins, family 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QET99138.1	1.04e-117	23	301	21	294
BBV07546.1	1.04e-117	23	301	21	294
QIB31157.1	1.04e-117	23	301	21	294
QUC26646.1	1.04e-117	23	301	21	294
AXO20211.1	1.04e-117	23	301	21	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VHA_A	7.24e-117	23	301	2	276	DEBP[Shigella flexneri],2VHA_B DEBP [Shigella flexneri]
2IA4_A	2.99e-111	23	301	2	276	Crystalstructure of Novel amino acid binding protein from Shigella flexneri [Shigella flexneri 2a str. 301],2IA4_B Crystal structure of Novel amino acid binding protein from Shigella flexneri [Shigella flexneri 2a str. 301]
5EYF_A	4.01e-20	62	272	40	236	CrystalStructure of Solute-binding Protein from Enterococcus faecium with Bound Glutamate [Enterococcus faecium DO],5EYF_B Crystal Structure of Solute-binding Protein from Enterococcus faecium with Bound Glutamate [Enterococcus faecium DO]
6SVF_A	2.08e-19	30	272	3	227	Crystalstructure of the P235GK mutant of ArgBP from T. maritima [Thermotoga maritima MSB8]
2V25_A	4.89e-19	23	271	26	257	Structureof the Campylobacter jejuni antigen Peb1A, an aspartate and glutamate receptor with bound aspartate [Campylobacter jejuni],2V25_B Structure of the Campylobacter jejuni antigen Peb1A, an aspartate and glutamate receptor with bound aspartate [Campylobacter jejuni]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9I402	1.05e-157	1	306	1	302	L-glutamate/L-aspartate-binding protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1342 PE=1 SV=1
P37902	5.39e-115	7	301	10	299	Glutamate/aspartate import solute-binding protein OS=Escherichia coli (strain K12) OX=83333 GN=gltI PE=1 SV=2
Q9ZF60	2.18e-114	29	301	32	299	Glutamate/aspartate import solute-binding protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=gltI PE=3 SV=3
O34563	7.80e-26	29	273	38	268	ABC transporter glutamine-binding protein GlnH OS=Bacillus subtilis (strain 168) OX=224308 GN=glnH PE=2 SV=1
P27676	8.13e-20	27	251	49	259	Glutamine-binding protein OS=Geobacillus stearothermophilus OX=1422 GN=glnH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000721	0.998241	0.000244	0.000309	0.000257	0.000215

TMHMM  Annotations     

start	end
7	29