CAZyme Information: MGYG000003208_00945

Basic Information

• Species: Pseudomonas_E extremaustralis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E extremaustralis
• CAZyme ID: MGYG000003208_00945
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240	MGYG000003208_14|CGC1	27146.21	10.0903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003208	6254364	MAG	United States	North America

• Gene Location: Start: 52826; End: 53548 Strand: -

Full Sequence      

MLRVLFKRFLNVVKWFAIGSVLLVLLLRVVPPPFTALMVERKIESWFDGEPIDLQRTWVQ
WDQISDDLKVAVMAGEDQRFPQHWGFDFGAIQAALAHNERGGSIRGASTLSQQVSKNLFL
WSGRSYLRKGLEAWFTGLIEVLWPKQRILEVYLNSVEWDEGVFGAQAAAQHHFGVSAKGL
SLQQASYLAAVLPNPRVWSASHPTAYVARRAAWIRQQMSQLGGNGYLVELNNSRKAPWAD

Enzyme Prediction     

No EC number prediction in MGYG000003208_00945.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	55	218	9.6e-51	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	7.89e-121	1	231	4	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.08e-93	5	223	3	223	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	6.01e-74	1	223	20	245	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.07e-65	48	218	1	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.10e-37	48	222	55	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDG10726.1	1.83e-175	1	240	1	240
QZP20996.1	4.65e-169	1	240	1	240
SDP38105.1	4.65e-169	1	240	1	240
ASV35484.1	9.38e-169	1	240	1	240
QDG57486.1	9.38e-169	1	240	1	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	3.72e-24	55	228	19	190	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	3.72e-24	55	228	19	190	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3DWK_A	3.17e-21	59	210	30	183	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	8.12e-21	59	210	39	192	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
4OON_A	1.57e-20	53	222	36	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C3K3M0	8.92e-168	1	240	1	240	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=mtgA PE=3 SV=1
Q3K584	7.91e-146	1	239	1	239	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mtgA PE=3 SV=1
Q4K4C2	1.70e-140	1	240	1	240	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mtgA PE=3 SV=1
Q48CL6	2.48e-132	1	235	1	235	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=mtgA PE=3 SV=1
Q88AF9	2.89e-131	1	235	1	235	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000006	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
9	31