CAZyme Information: MGYG000003199_00744

Basic Information

• Species: HGM05190 sp900759815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; HGM05190; HGM05190 sp900759815
• CAZyme ID: MGYG000003199_00744
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273	MGYG000003199_65|CGC1	31420.9	4.7241

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003199	2346212	MAG	United States	North America

• Gene Location: Start: 1487; End: 2308 Strand: -

Full Sequence      

MARQKEKILYIAQEINPYLPESEMSINSRQIFQGIAERGFEVRTFMPKYGCINERRNQLH
EVIRLSGMNIIIDDTDHPLIIKVATLQPTRMQVYFIDNEDFFMRPPVKELELTLSPQDND
ERIMFFVRGVVETVKKLRWEPAVIHCSGWIAALAPLYLKHIYNDDPSFRNAKIVYSLHRR
GFEGSLDPRFAEKLKMDGFTDEDIKALGIDPVDFTALSHLAIDYADAVVIANPDADPDLI
EYARNAGKVLLDYSEPDVAADNYAKFYNELLSE

Enzyme Prediction     

No EC number prediction in MGYG000003199_00744.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	7	230	8.2e-40	0.4470338983050847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	8.77e-44	8	228	1	213	Starch synthase catalytic domain.
PRK14098	PRK14098	1.41e-41	1	229	1	236	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	5.04e-30	7	229	1	213	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	1.19e-23	36	228	31	201	glycogen synthase GlgA.
COG0297	GlgA	6.18e-22	6	233	1	217	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD40988.1	2.00e-129	4	273	2	271
QCD35816.1	3.39e-129	7	270	5	269
QCP71410.1	3.83e-127	6	273	4	271
QCD40308.1	3.83e-127	6	273	4	271
QQR09950.1	1.51e-121	6	270	4	271

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3B6C3	2.04e-39	1	194	1	195	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
A4SCU9	2.83e-39	1	246	1	242	Glycogen synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) OX=290318 GN=glgA PE=3 SV=1
B3QR00	3.88e-39	1	233	1	229	Glycogen synthase OS=Chlorobaculum parvum (strain DSM 263 / NCIMB 8327) OX=517417 GN=glgA PE=3 SV=1
Q8KAY6	2.01e-38	1	213	1	222	Glycogen synthase OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=glgA PE=3 SV=1
A1BIY8	7.61e-38	1	228	1	235	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003199_00744.