CAZyme Information: MGYG000003196_01857

Basic Information

• Species: Corynebacterium sp900539985
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium sp900539985
• CAZyme ID: MGYG000003196_01857
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		21991.41	7.874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003196	2252984	MAG	United States	North America

• Gene Location: Start: 67; End: 696 Strand: -

Full Sequence      

MGRHSAKNRMAAKFTAGTVAFGAAAAIMAPTASAAPDSDWDRLAQCEAGGNWHINTGNGY
QGGLQFNPQTWQANGGGEFAATADQATREQQIVVAERVLASQGWGAWPACSASLGLNSAP
TQRTAPSAAPKAPAQAPAPVKQAAAQKSDELAVDALYNTIKNAANSYGLALPAQFTELYK
ANRHDFNNFYSANRNVIDPIAQMIENITR

Enzyme Prediction     

No EC number prediction in MGYG000003196_01857.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06737	Transglycosylas	1.85e-37	36	110	1	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
cd13925	RPF	7.05e-29	38	110	1	71	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam11574	DUF3235	3.53e-20	116	194	1	82	Protein of unknown function (DUF3235). Some members in this family of proteins with unknown function are annotated as RpfA however this cannot be confirmed.
cd00442	Lyz-like	7.53e-04	40	76	2	40	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQU81287.1	2.41e-142	1	209	1	209
QRQ67012.1	2.31e-140	1	209	1	209
QQA99553.1	2.31e-140	1	209	1	209
QQN47316.1	6.63e-140	1	209	1	209
QRJ57331.1	1.87e-111	1	209	1	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KL7_A	6.09e-30	38	115	1	78	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_A Chain A, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
4EMN_A	6.26e-30	38	115	2	79	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_B Chain B, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_C Chain C, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_D Chain D, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
1XSF_A	1.36e-29	38	115	29	106	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
3EO5_A	7.91e-29	38	115	92	169	ChainA, Resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
5E27_A	5.13e-28	38	115	169	246	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],5E27_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6M6W5	6.69e-65	1	181	1	190	Resuscitation-promoting factor Rpf1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf1 PE=3 SV=1
Q6M6N7	1.10e-33	25	116	282	373	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1
P9WG31	1.92e-32	2	133	3	136	Resuscitation-promoting factor RpfA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfA PE=1 SV=1
P9WG30	1.92e-32	2	133	3	136	Resuscitation-promoting factor RpfA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=rpfA PE=3 SV=1
H8EZH5	2.13e-26	38	115	283	360	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000312	0.998830	0.000194	0.000260	0.000200	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003196_01857.