CAZyme Information: MGYG000003187_02408

Basic Information

• Species: Leclercia adecarboxylata_C
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Leclercia; Leclercia adecarboxylata_C
• CAZyme ID: MGYG000003187_02408
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
148	MGYG000003187_7|CGC1	17066.68	9.175

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003187	4670976	MAG	United States	North America

• Gene Location: Start: 40511; End: 40957 Strand: -

Full Sequence      

MKRLIFLLLMISQSTMANCWDNAAHYYHVDPWLLFAIAKVESGMNPYAVGWNHDGSRDVG
LMQINSSHFSELQRLGINESRLITEPCTSIMVGASILSDMIKVYGYNWEAVGAYNAGAKK
ENYPQRMMYAHKVWAKYREIKAKQSYRY

Enzyme Prediction     

No EC number prediction in MGYG000003187_02408.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	28	146	2.4e-24	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	2.19e-85	1	147	1	149	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	1.42e-51	27	138	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	7.48e-27	20	118	1	96	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	2.24e-25	4	147	6	152	lytic transglycosylase; Provisional
cd00254	LT-like	2.05e-16	31	117	1	81	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGU14562.1	5.15e-105	1	148	1	148
QDK19937.1	2.10e-104	1	148	1	148
QPK01938.1	1.52e-88	1	148	1	148
BBS36507.1	1.52e-88	1	148	1	148
QNR10708.1	2.20e-87	1	142	1	142

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	5.62e-11	18	102	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	1.51e-45	4	141	6	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	1.51e-45	4	141	6	143	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	6.09e-45	4	141	6	143	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q55287	2.39e-35	1	142	1	143	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1
Q07568	9.61e-35	1	142	1	143	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001466	0.995109	0.002694	0.000237	0.000217	0.000222

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003187_02408.