CAZyme Information: MGYG000003187_01168

Basic Information

• Species: Leclercia adecarboxylata_C
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Leclercia; Leclercia adecarboxylata_C
• CAZyme ID: MGYG000003187_01168
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000003187_3|CGC2	38498.14	7.0275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003187	4670976	MAG	United States	North America

• Gene Location: Start: 187795; End: 188799 Strand: -

Full Sequence      

MSIDIIVASTLKRIGFPDIIWENRVEKLKSSVAKYENQSVTILHNCKACHSDLFSPGTAR
NEIINKSCVENIFICDADLLIPELLLDNLDFFASQLNNSATQAFEMYPCLYLTKEETERF
DGDFQGCLESFLRGENHRVEGIALASSCLLLNREWFLQLGGFDERFVGHGGEDLELIDRL
CQHYPIGPRPSDYGLNIKAQHPGDYQGFRRYFSYYALPHLFAGRFLVHQWHPRPLTHPYH
KRRAGNDALLEQMLANPGPLKGPVIPCNDLNGELPDFREWMIRLQEEAGYPVSEYPGLLR
WKDGVTVKRPLWRKMRKLYLNPKAFFKDMVKSKS

Enzyme Prediction     

No EC number prediction in MGYG000003187_01168.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	50	249	1.3e-27	0.7463768115942029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10111	Glyco_tranf_2_2	3.50e-24	54	256	67	276	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
COG4092	COG4092	2.54e-21	50	256	72	292	Predicted glycosyltransferase involved in capsule biosynthesis [Cell wall/membrane/envelope biogenesis].
cd06420	GT2_Chondriotin_Pol_N	2.69e-06	32	180	44	162	N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase. Chondroitin polymerase is a two domain, bi-functional protein. The N-terminal domain functions as a GalNAc transferase. The bacterial chondroitin polymerase catalyzes elongation of the chondroitin chain by alternatively transferring the GlcUA and GalNAc moiety from UDP-GlcUA and UDP-GalNAc to the non-reducing ends of the chondroitin chain. The enzyme consists of N-terminal and C-terminal domains in which the two active sites catalyze the addition of GalNAc and GlcUA, respectively. Chondroitin chains range from 40 to over 100 repeating units of the disaccharide. Sulfated chondroitins are involved in the regulation of various biological functions such as central nervous system development, wound repair, infection, growth factor signaling, and morphogenesis, in addition to its conventional structural roles. In Caenorhabditis elegans, chondroitin is an essential factor for the worm to undergo cytokinesis and cell division. Chondroitin is synthesized as proteoglycans, sulfated and secreted to the cell surface or extracellular matrix.
pfam02709	Glyco_transf_7C	1.25e-05	149	180	24	55	N-terminal domain of galactosyltransferase. This is the N-terminal domain of a family of galactosyltransferases from a wide range of Metazoa with three related galactosyltransferases activities, all three of which are possessed by one sequence in some cases. EC:2.4.1.90, N-acetyllactosamine synthase; EC:2.4.1.38, Beta-N-acetylglucosaminyl-glycopeptide beta-1,4- galactosyltransferase; and EC:2.4.1.22 Lactose synthase. Note that N-acetyllactosamine synthase is a component of Lactose synthase along with alpha-lactalbumin, in the absence of alpha-lactalbumin EC:2.4.1.90 is the catalyzed reaction.
cd04186	GT_2_like_c	2.50e-04	147	180	115	147	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNB42275.1	1.04e-180	59	334	2	277
QSR70786.1	1.27e-170	54	334	4	288
QSR83320.1	1.27e-170	54	334	4	288
QSR79129.1	1.27e-170	54	334	4	288
QSR62429.1	1.27e-170	54	334	4	288

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003187_01168.