CAZyme Information: MGYG000003179_00362

Basic Information

• Species: UMGS1004 sp900547645
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UMGS1004; UMGS1004 sp900547645
• CAZyme ID: MGYG000003179_00362
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
716		79521.86	6.2784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003179	1597931	MAG	United States	North America

• Gene Location: Start: 37088; End: 39238 Strand: -

Full Sequence      

MKGIFIGTAENADTFTVSKTFYADRAGRATLRATALGVYFAQLNGRRVGDAYLAPGWTSY
RHTLQVQEYAVDVREGENVLSFTVNAGWYCGPLTWEHAACKYGDRPAVCAELSADGLCVC
TDGSWTASESAIRSSGIYDGEHVDLTAELRALHIAEVPFGGARLVPQIGEPVRDTERLSV
RRVFRTPKGELVYDFGQNLAGIAEVRTPQDFDGTLTLKFAEILVGGNFYTENLRSAKATD
TFTAKGAHTFRPEFTFHGFRYLMLEGAELPAENVTAVVRHTDMRRTGRIETSDPALNRLF
ENVVWGQRGNFVDLPTDCPQRDERLGWTGDINVFCRTAAFNYDVRGILRKWLCDVRSDQA
ETGEIPHVAPDCLNKKSTAAMWCDAVTMVPWKLYRMYGDESFLSENYGAMKKFVSARERT
MENGLIVRGHEYGDWLALDKEVLLADGPGGRTDVYFLANALHLHTLHIVAETARILGTGE
EVLYRGKREALLRRMREEYVTPGGRLALDTVTAQAIALQFGIVPPEHRARLAAELNANVL
RHGCRVSTGFIGTPYLLFALADHGYSDTAEKVLLNPEYPGWLYEVRMGATTVWERWNSLM
PDGTPNPDGMNSYNHYAYGSVMEFVYRRVAGIEEAQAGFTQIRIAPMPLAAVDRVYAEYE
SVAGRIAAGYERKNGAIVYHAEVPAGASAEIVLPGEAPVRVGAGRYSYERRAADRR

Enzyme Prediction     

EC	3.2.1.40	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	184	693	9.5e-161	0.996031746031746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.17e-134	284	629	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.62e-41	28	176	5	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.23e-24	185	280	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.26e-14	631	706	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLG40468.1	1.36e-189	28	709	139	832
QRT30265.1	2.40e-181	19	709	130	831
QRT50983.1	8.17e-180	29	709	140	836
BAJ74951.1	1.10e-179	23	694	33	725
AET62005.1	5.07e-178	15	695	140	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	3.35e-143	29	708	147	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	3.26e-141	25	701	315	1002	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	6.25e-89	14	694	182	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.32e-140	25	701	315	1002	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.07e-127	29	694	190	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	9.81e-115	29	694	186	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	4.08e-50	36	693	207	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999640	0.000364	0.000052	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003179_00362.