CAZyme Information: MGYG000003178_02206

Basic Information

• Species: Klebsiella quasivariicola
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella; Klebsiella quasivariicola
• CAZyme ID: MGYG000003178_02206
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		43781.98	6.2856

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003178	3011876	MAG	United States	North America

• Gene Location: Start: 105; End: 1244 Strand: +

Full Sequence      

MKVWPVKHSPLLCQPERFIARSELQALIRNVTQNLVNIKDESGQFLLRLDDGRVIDTKGW
AGWEWTHGVGLYGIYQYYQQTGDIEMRDIIDRWFDERFAEGATTKNVNTMAPFLTLAYRF
EETGRRAYLPWLESWAEWAMHEMPRTEQGGMQHITLAEENHQQIWDDTLMMTVLPLAKIG
KLLNRPQYVEEATYQFLLHVQNLMDRETGLWFHGWSYEGRHNFARARWARGNSWLTMVIP
DFLELVDLPEGNAVRRYLMAVLNAQIAALAKCQDDSGLWHTLLDDPHSYPEASATAGFAY
GILKAVRKRYVGQHYAGVAEKAIRGIVRNISPEGELLQTSFGTGMGSDLDFYRQIPLTSM
PYGQAMAILCLTEYLRKYF

Enzyme Prediction     

No EC number prediction in MGYG000003178_02206.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	376	5.4e-116	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.39e-143	29	379	2	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.32e-127	37	378	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBL48825.1	4.73e-291	1	379	1	379
ASV19656.1	1.36e-290	1	379	1	379
AQL21920.1	1.20e-284	1	379	1	379
QKK54234.1	1.20e-284	1	379	1	379
AJA98058.1	1.20e-284	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	4.08e-269	2	379	5	382	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	1.82e-242	3	379	5	381	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	4.76e-154	22	378	6	372	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	2.87e-24	63	327	23	299	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	7.66e-18	187	357	224	392	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	2.90e-53	63	376	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	2.05e-09	180	307	10	143	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.05e-09	180	307	10	143	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003178_02206.