CAZyme Information: MGYG000003163_01316

Basic Information

• Species: Phocaeicola sp900546645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546645
• CAZyme ID: MGYG000003163_01316
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802		90610.86	7.1876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003163	2819390	MAG	United States	North America

• Gene Location: Start: 19755; End: 22163 Strand: +

Full Sequence      

MKKLMISAMLFSMICGGTQAQKKAQVHGYPIDPVPFTSVKVTDSFWGQRLKASREVTIPL
AFSKCEETGRYKNFEMAAHPSESNKVEGLAFDDTDVYKTIEGASYLLQTYPDKQLKKYID
SVLVIVAAAQEPDGYLYTMRTMNPKHPHEWAGSKRWEKVEDLSHEFYNLGHMVEGAIAHY
QATGKRNFLDIAIRYADCVCREIGDGPDQVVRVPGHQIAEMALAKLYLVTGEQKYLDQAK
FFLDKRGYTSRRDEYSQAHLPVIEQDEAVGHAVRAAYMYAGMADVAALTGDTAYIHAIDR
IWDNIVTKKLYITGGIGATNNGEAFGKNYELPNMSAYCETCAAIGNVYVNYRLFLLHGDS
KYYDVLERTLYNGLISGVSLDGGGFFYPNPLESMGQHQRQPWFGCACCPSNICRFIPSLP
GYVYAVKDKDVYVNLFMANDATLQVNGKKVTLKQTTSYPWNGDVNILVDRNSAGQFAMKI
RIPGWVQNQVVPSDLYTYTDGVRPKYNVKVNGEEVKADLQQGYFTIDRKWKKGDKVEVHF
DMNVRTVKANSKVEADRGRIAIERGPVVYCAEWPDNNFDVLSVLMNRTPKFEVVSRKDLL
YGLNQIKTQAQTLEYDESGRLTTKDQTLTLIPYYAWAHRGSGNMAVWLPNEVSATRPATI
PTLASKSKVDASHKVTSLRSITDGLVPKDENDRTAPYYHWWPKEGTTEWISYEFPEEMTV
SSSTVYWYDDAPWGGCRVPKSWKIYYKDAAGKWVPVQNLNEYGVKKGNPNIVDFEPVKTT
AVKLEVVQPDKNSSGLFEWEVK

Enzyme Prediction     

No EC number prediction in MGYG000003163_01316.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	39	570	7.4e-214	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	0.0	30	648	2	585	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	0.0	38	570	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG1331	YyaL	0.001	222	370	419	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
pfam00754	F5_F8_type_C	0.001	689	801	19	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd04791	LanC_SerThrkinase	0.002	180	301	99	230	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR57394.1	0.0	1	802	1	801
QJR78977.1	0.0	1	802	1	801
AII67308.1	0.0	1	802	1	801
QJR57810.1	0.0	1	802	1	801
ALA73152.1	0.0	1	802	1	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	0.0	27	655	3	630	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	6.21e-151	37	648	14	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.03e-145	37	648	14	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.69e-109	38	647	2	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	2.26e-109	38	647	2	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	9.23e-109	38	647	2	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1
E8MGH9	6.31e-06	651	800	1138	1298	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001402	0.804039	0.193347	0.000582	0.000329	0.000267

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003163_01316.