CAZyme Information: MGYG000003163_00632

Basic Information

• Species: Phocaeicola sp900546645
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546645
• CAZyme ID: MGYG000003163_00632
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310	MGYG000003163_13|CGC1	36220.33	10.0209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003163	2819390	MAG	United States	North America

• Gene Location: Start: 33080; End: 34012 Strand: +

Full Sequence      

MAKEPPTTAVNRPRKAGTKSRTATRKASAAGKRKAKQAEQSRKDLSSWFYYLAMGVAAVI
FTAFFYYFFIRPYAYRWKPCSGLKAYGVCLPYGYKVHGFDISHHQENINWAELSRAKHTP
FPVRFVFIKASEGGDFNDSAFRQNFEQARKYGFIRGAYHFYNPNTDALRQADFFIRTVKL
EPGDLPPVLDIEKKGKDIEKLRHDLKIWLDRIEAYYHVKPILYTSYKFKTRYLNDSVFNS
YPYWIAHYYVDSVEYRGEWKFWQHTDAGTLPGIRKQVDLNVFNGSIEELEEMTVRSLLQD
SLKNGPKKTL

Enzyme Prediction     

No EC number prediction in MGYG000003163_00632.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	100	273	4.3e-52	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	1.30e-82	97	284	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	1.23e-69	94	284	1	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	3.15e-56	97	282	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	1.51e-52	100	273	2	180	Glycosyl hydrolases family 25.
COG3757	Acm	4.73e-48	94	291	61	262	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25286.1	2.02e-151	1	299	1	293
ADY35571.1	2.79e-143	1	294	1	303
QJR56286.1	7.58e-140	14	295	8	287
QUT59153.1	7.58e-140	33	295	27	287
QJR58916.1	7.58e-140	14	295	8	287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	6.28e-28	94	290	14	214	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	1.76e-22	96	289	5	209	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	2.96e-19	96	286	20	211	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.67e-18	96	286	20	211	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
6ZMV_A	4.14e-15	96	292	2	203	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76421	4.21e-51	75	306	49	272	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	5.94e-51	75	290	49	262	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	9.26e-50	75	306	49	272	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	4.09e-21	96	289	82	286	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	9.19e-19	96	290	9	204	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999891	0.000108	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
48	70