CAZyme Information: MGYG000003144_03978

Basic Information

• Species: Aeromonas rivipollensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas rivipollensis
• CAZyme ID: MGYG000003144_03978
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	MGYG000003144_24|CGC1	66105.15	8.9312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003144	4456944	MAG	United States	North America

• Gene Location: Start: 12305; End: 14068 Strand: +

Full Sequence      

MNILMALSQLEVTGAEVYATTVGNELTRRGHNVFYVSDTLTKPTQGPVFKLRFNKRSILR
RFWHVFYLIYLIRKHHIQLVHAHSRASGWSSYVACKLTGTPMITTVHGRQPVHASRKAFH
ALGYRAVAVCEDIARQIIDNLGVDPATVQVLRNGIETDRFQPVPAPDNVRPVIAIIGRLS
GPKGELCYRLLDEVLDLDACQVRVVSGTRVPERFARFQDKVDFVGYVDDVPALLAQCDLV
IGAGRVAMEALLCGRPAFAIGEAKAIGLVTEQNLDEALASNFGDIGPQDLAIDFAALKGQ
IAPALASKRVPDSLRQRILQEYDLQEVVNGLESIYQDAVVETLRREMPVIMYHRFIEHEN
EKGVHGTWLPVAMFEKHLKLMKWLGYETLTFADLADKGFIHRLQHGKKYLMITVDDGYRD
NLTRMLPLLEKYGYKAVVYIVTGEDHNRWDVEHPTHPDTPVALMNGDEIRALVASGHVEI
GGHTLTHPRLSTLKPEQQAREIRANKERLERLLGHPLLSFAYPYGDLNESAKAEASAAGY
RYAVATNSGPRAMHRDPLQIRRIAIFPRTDMFGLWRKIRGNYVFRKS

Enzyme Prediction     

EC	2.4.1.-	3.5.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	404	546	8.8e-35	0.9461538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03819	GT4_WavL-like	1.27e-81	3	307	1	336	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
cd10918	CE4_NodB_like_5s_6s	3.52e-51	409	568	1	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	1.29e-36	374	579	4	215	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
COG0726	CDA1	7.04e-33	347	562	1	206	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam01522	Polysacc_deac_1	3.62e-29	406	543	5	124	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHE47600.1	0.0	1	587	1	587
QJT23818.1	0.0	1	587	1	587
QYK80625.1	0.0	1	587	1	587
AVP92414.1	0.0	1	587	1	587
BBS89264.1	0.0	1	587	1	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GO1_A	3.27e-19	342	571	95	310	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]
4HD5_A	1.91e-17	342	571	139	352	CrystalStructure of BC0361, a polysaccharide deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]
4V33_A	8.29e-17	342	571	139	352	Crystalstructure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis],4V33_B Crystal structure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis]
6DQ3_A	1.35e-14	346	567	8	217	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
7MI0_A	4.94e-14	71	339	96	393	ChainA, Glycosyltransferase [Rickettsia africae ESF-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	1.17e-19	346	567	64	264	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
P31666	4.58e-09	347	581	170	405	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2
A4X1R6	1.48e-06	76	341	157	469	D-inositol 3-phosphate glycosyltransferase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) OX=369723 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999647	0.000312	0.000033	0.000001	0.000001	0.000014

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003144_03978.