CAZyme Information: MGYG000003144_00900

Basic Information

• Species: Aeromonas rivipollensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas rivipollensis
• CAZyme ID: MGYG000003144_00900
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866	MGYG000003144_2|CGC6	96282.14	6.3479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003144	4456944	MAG	United States	North America

• Gene Location: Start: 316435; End: 319035 Strand: -

Full Sequence      

MKILYPMQVGGGDAPKEVASLEEFIGKLNGEPGGTFLLGGNRIWHGGIHLSDKGGWHPQG
AVRAIADGEIVAYRIASAPAAVKLEPEEGKPGEPITLHTSPSFCLVRHRYEATEEVSGQQ
QPKRNTLTFYCLYMHIACKNAYQGEPERHVLTGSGVAIYKATASLQFQKEDKLGTARKGA
EVTLIGAPSERMNLKNEPYSYQLVSYATPKGDDPSAFYVASQFIKEERKVEPDWMMAKQD
IPSLYPISRNSYLRKSKDQGEAVTAGLPKTSKVARTTAQPVVFSNMKEYLEIEVWEVAQG
KLTDGKGNVVPNASKGDRYWVAKEMLGQPSDAVRYTPIVYDKVELRHTNPIPVKVGEVVG
HWGEHETPKPTASGFVLNEDRKAIHMEIFVAESDKEALGKCISNEGKLTKGQEYLLLKEG
GQVDTYNLTKEKNKVGYSKVGAFGPLAAPKPIKTQDIVTHGADKFVKVAEDQHVLISGDT
KLVSQHEWARLGVTLVDGGSDPDGFLDKADTDGKEGGDFFSTLYEELVTDRDGDGSISAD
EIKAAMAEKMVADKVRNLFIKHESEWVKRDTWPRLEQELKNMPNLCKYVLEVTNKMAWIE
EAAAVVGDAKPWFINPAGMMGLVADPISYNEMDEEWLTVPKGQLTFDAEGNDVDTSMYFS
RHPHVPNNRGVVIGASGVTYGRGLDLGQISIGELNKLANTISNNCMPLSSSMLRWLKGAV
GLQRQAAYEYTLEINNAVPRAEQTLTRKQQHYLFNDIYLKLESTAKRTIENPKGARTRTN
PKGIDLDPEKIVSWDPLPQNIKDVLVDLTFRGDNRPSTREFFIPELIESIKADDGFATFK
NNVKNSKWKDDFNVPLDRYQRRCNYL

Enzyme Prediction     

No EC number prediction in MGYG000003144_00900.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16903	pesticin_lyz-like	8.50e-61	637	811	1	150	pesticin C-terminal-like domain of uncharacterized proteins. This subfamily is composed of uncharacterized proteins containing a lysozyme-like domain similar to the C-terminal domain of pesticin. Some members also contain an EF hand domain. Pesticin (Pst) is an anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. Pst contains an N-terminal translocation domain, an intermediate receptor binding domain, and a phage-lysozyme like C-terminal activity domain. Bacteriocins such as pesticin are produced by gram-negative bacteria to attack related bacterial stains. Pst is transported to the periplasm via FyuA, an outer-membrane receptor of Y. pestis and E. coli, where it hydrolyzes peptidoglycan via the cleavage of N-acetylmuramic acid and C4 of N-acetylglucosamine. Disruption of the peptidoglycan layer renders the bacteria vulnerable to lysis via osmotic pressure. The pesticin C-terminal domain resembles the lysozyme-like family, which includes soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides.
cd12799	pesticin_lyz-like	1.00e-11	650	811	1	129	lysozyme-like C-terminal domain of pesticin and related proteins. Pesticin (Pst) is an anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. Pst contains an N-terminal translocation domain, an intermediate receptor binding domain, and a phage-lysozyme like C-terminal activity domain. Bacteriocins such as pesticin are produced by gram-negative bacteria to attack related bacterial stains. Pst is transported to the periplasm via FyuA, an outer-membrane receptor of Y. pestis and E. coli, where it hydrolyzes peptidoglycan via the cleavage of N-acetylmuramic acid and C4 of N-acetylglucosamine. Disruption of the peptidoglycan layer renders the bacteria vulnerable to lysis via osmotic pressure. The pesticin C-terminal domain resembles the lysozyme-like family, which includes soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides.
pfam16754	Pesticin	1.42e-05	664	730	19	73	Bacterial toxin homolog of phage lysozyme, C-term. This the C-terminal activator domain of pesticin, a hydrolase enzyme secreted by Yersinia pestis and other Gammaproteobacteria to kill related bacteria occupying the same ecological niche. It is referred to as a bacteriocin and it leads to the hydrolysis of peptidoglycan. Its immunity protein is Pim. Pesticin carries an elongated N-terminal translocation domain, an intermediate receptor binding domain, and a C-terminal activity domain with structural analogy to lysozyme homologs. The full-length protein is toxic to bacteria when taken up to the target site via the outer or the inner membrane. The receptor domain is necessary for the close contact with the outer membrane; the N-terminal is a type of translocational, TonB box; the C-terminal domain is the death-delivering domain.
cd16902	pesticin_lyz	1.26e-04	659	862	13	170	lysozyme-like C-terminal domain of pesticin. Pesticin (Pst) is an anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. Pst contains an N-terminal translocation domain, an intermediate receptor binding domain, and a phage-lysozyme like C-terminal activity domain. Bacteriocins such as pesticin are produced by gram-negative bacteria to attack related bacterial stains. Pst is transported to the periplasm via FyuA, an outer-membrane receptor of Y. pestis and E. coli, where it hydrolyzes peptidoglycan via the cleavage of N-acetylmuramic acid and C4 of N-acetylglucosamine. Disruption of the peptidoglycan layer renders the bacteria vulnerable to lysis via osmotic pressure. The pesticin C-terminal domain resembles the lysozyme-like family, which includes soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIO18832.1	0.0	1	625	1	625
QWL63904.1	0.0	1	643	1	647
AGM43789.1	0.0	28	625	2	599
AJE36719.1	0.0	28	625	2	599
AHX32471.1	0.0	28	625	2	599

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003144_00900.