CAZyme Information: MGYG000003144_00240

Basic Information

• Species: Aeromonas rivipollensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas rivipollensis
• CAZyme ID: MGYG000003144_00240
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236	MGYG000003144_1|CGC3	25578.65	9.5077

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003144	4456944	MAG	United States	North America

• Gene Location: Start: 267848; End: 268558 Strand: -

Full Sequence      

MKAWMLLGAIPLFPLSAWSQTPPPAEVVVLTSESIPSPKVAEPAPPPAARQIQVYKSVQK
NGVVRYSDMMPEQGHYELLLFNDCYACDPASRINWRTTGLFLYDYASTIQAAAKTYQVEP
ALIRALIHAESAFNPLAVSRKGAMGLTQLMPATARELGVGNALMAEQNIFGGVKYLAGLL
KQYDGNVALATAAYNAGAGAVQKHGGIPPYAETRAYVARVKLLHQRYKEMLSARGL

Enzyme Prediction     

No EC number prediction in MGYG000003144_00240.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	116	223	1.1e-27	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.15e-44	120	220	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.91e-41	100	220	1	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.35e-39	103	226	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	8.71e-33	109	216	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	2.19e-28	109	208	1	113	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHE50471.1	1.90e-166	1	236	1	236
AVP93470.1	1.45e-160	5	236	1	232
QIY89026.1	1.45e-160	5	236	1	232
QYK83299.1	1.69e-159	5	236	1	232
QJT24209.1	1.69e-159	5	236	1	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FPN_B	1.01e-12	101	233	422	571	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O1J_A	1.01e-12	101	233	416	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.01e-12	101	233	412	561	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O29_A	1.02e-12	101	233	432	581	Lytictransglycosylase in action [Neisseria meningitidis]
5O24_A	1.02e-12	101	233	426	575	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.76e-34	103	220	58	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.34e-31	97	220	1414	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.34e-31	97	220	1414	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	1.75e-14	108	220	10	115	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q4ZX03	2.57e-10	58	199	250	389	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001725	0.985095	0.012365	0.000284	0.000251	0.000249

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003144_00240.