CAZyme Information: MGYG000003142_00631

Basic Information

• Species: Clostridium_J sp900547625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_J; Clostridium_J sp900547625
• CAZyme ID: MGYG000003142_00631
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222		25738.91	10.2139

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003142	3709509	MAG	United States	North America

• Gene Location: Start: 47554; End: 48222 Strand: -

Full Sequence      

MYKMYLGINNGEEGFMLPVLPEKIELNEDGDNKTYDIINLGEINTINLPKLTEISFEGFF
PKHKGPYVSSEQLFEPSFYISKIREWRDKKQKVRFIFVGSPLEINDLFTIESFKPSENGG
EVGDIYYSIELKKYKNYGAKKVVIIKPKNNVTKKVAKINKKPPRPVTKPKVRTHTVVRGD
TLWHIAKRYLGNGSKWPQIYNLNKDKIKNPNLIYPGQVFRLP

Enzyme Prediction     

No EC number prediction in MGYG000003142_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	174	222	3.5e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	1.05e-18	155	222	79	146	LysM domain/BON superfamily protein; Provisional
COG1652	XkdP	4.79e-15	79	222	137	262	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
cd00118	LysM	4.52e-12	172	221	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
NF033163	lipo_LipL71	5.11e-12	145	222	355	460	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.
pfam01476	LysM	7.27e-09	174	222	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA42537.1	2.44e-142	2	222	3	224
AJA42672.1	2.63e-139	1	222	1	223
ADG00054.1	5.56e-130	1	222	1	225
APC81798.1	6.33e-128	1	222	1	220
QMU01763.1	6.79e-128	2	222	3	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6VE2_O	1.19e-08	174	221	31	77	ChainO, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_P Chain P, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_Q Chain Q, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_R Chain R, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_S Chain S, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_T Chain T, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_U Chain U, LysM domain-containing protein [Pseudomonas aeruginosa PAO1]
5FIM_A	3.40e-08	174	222	99	147	Thestructure of Kbp.K from E. coli [Escherichia coli],7PVC_A Chain A, Potassium binding protein Kbp [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45932	3.12e-34	8	222	10	218	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1
P54335	4.85e-33	8	222	10	218	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
P0ADE6	1.63e-07	174	222	99	147	Potassium binding protein Kbp OS=Escherichia coli (strain K12) OX=83333 GN=kbp PE=1 SV=2
P0ADE7	1.63e-07	174	222	99	147	Potassium binding protein Kbp OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=kbp PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003142_00631.