CAZyme Information: MGYG000003139_00466

Basic Information

• Species: Clostridium_G cochlearium
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_G; Clostridium_G cochlearium
• CAZyme ID: MGYG000003139_00466
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466	MGYG000003139_3|CGC1	54263.42	8.8982

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003139	2361241	MAG	United States	North America

• Gene Location: Start: 6134; End: 7534 Strand: +

Full Sequence      

MNNFVFLATSVFQIVVFLMTMYYFILSLFGLHKKDEVDGNLVKPEKTFALIVAAHNEETV
IGHIIDSLKKLDYPDNLYDIFVIADNCTDDTAKISKKLDVNVFERNVPSKRGKGYALEWM
FDKIFKMEKKYDAIAVFDADNLVSANFLKEMNAKLLDGYKVVQGYIDSKNPEDSWITQSY
SISFWTANRLFQLARWNLGLSNQIGGTGFCMETDILKQLGWGATCLTEDLEFTCKLVLNG
HKVGWSHNAIVYDEKPLTLKQSWSQRKRWMQGFADVSSRFFAKLMKKAIKDRDFRAFDCA
LYSIQPFFTLLLAISAILTMMQNSSANGLNIFVINSLFAPWIWKVFSIFQFLFTPFIMLL
EEKLHKKMFFVFSIYSLNIFFNEIIFGNNPKLFEVVLGSILYFSLFVLILFIFNKKHYIT
LFIWYLLYGFYTLTWIPITVQGILNKNNKEWSHTKHTRKITIQDVE

Enzyme Prediction     

No EC number prediction in MGYG000003139_00466.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	47	271	1.6e-30	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	1.24e-92	51	232	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	1.29e-41	50	229	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.64e-41	4	434	13	428	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	4.14e-27	47	272	3	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06427	CESA_like_2	1.82e-17	47	273	2	230	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV76277.1	0.0	1	466	1	466
AAO35885.1	0.0	1	466	1	466
AVP53784.1	0.0	1	466	1	466
CDI49425.1	5.82e-250	1	375	1	376
QAT40246.1	2.74e-249	1	466	1	466

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	2.40e-17	44	272	106	335	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	3.06e-17	32	272	96	333	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	2.32e-16	32	272	96	333	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q47536	2.01e-06	204	285	186	266	Uncharacterized glycosyltransferase YaiP OS=Escherichia coli (strain K12) OX=83333 GN=yaiP PE=3 SV=2
P75905	8.96e-06	42	287	71	314	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
300	322
337	359
368	387
392	414
421	443