CAZyme Information: MGYG000003135_00879

Basic Information

• Species: Cutibacterium granulosum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Cutibacterium; Cutibacterium granulosum
• CAZyme ID: MGYG000003135_00879
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000003135_4|CGC1	39161.89	9.6652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003135	2072889	MAG	United States	North America

• Gene Location: Start: 80357; End: 81475 Strand: -

Full Sequence      

MVNVVLAGGGTAGHTSPLIATAQQLVGMAQVEQVSCIGTPKGLEGRVIPDAGLQIDMIPP
VPLPRKFSVDLVKVPARLVGAVRRASEVLEARGADVVIGFGGYVSMPAYLAARSRHIPVV
VHEQNAVPGLANKVAARFAAGVYTAFPDTPLPGAEFIGMPLRANVAELANLDERDRADRR
RRTRREFGLDEDRPTLLVSGGSQGAVSVNTAVVQARGQLLADGVQVLHVLGPRNVADART
HTDDSTGARWVPVAYVDDMARAYAAADLMVARSGAGTVVETAVCGLPTIYVPLPHGNGEQ
ARNASSVVAAGGGVLIRDDELNATRLMREVARIHHPDELARMSMAGRDLMSTQAAQNLAQ
AVVSAATRRKKK

Enzyme Prediction     

No EC number prediction in MGYG000003135_00879.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	195	350	2.6e-44	0.9681528662420382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	2.27e-125	1	366	1	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	3.75e-106	4	359	2	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	2.75e-97	4	368	3	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.66e-88	4	362	3	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam03033	Glyco_transf_28	1.31e-40	4	144	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV39492.1	4.60e-251	1	371	1	371
AOZ45575.1	1.60e-173	1	368	1	368
AZP38416.1	1.60e-173	1	368	1	368
AMS06789.1	1.60e-173	1	368	1	368
QCV95360.1	1.60e-173	1	368	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	3.48e-50	4	331	9	320	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	5.33e-49	3	366	4	355	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	4.08e-40	3	358	11	358	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
4WYI_A	9.93e-06	184	313	202	333	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6A9Q2	3.97e-172	1	367	1	365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=murG PE=3 SV=1
A1SL80	8.54e-116	2	363	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Nocardioides sp. (strain ATCC BAA-499 / JS614) OX=196162 GN=murG PE=3 SV=1
Q73YQ8	1.20e-99	2	363	32	391	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) OX=262316 GN=murG PE=3 SV=1
Q5YYX9	1.52e-98	2	330	15	340	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Nocardia farcinica (strain IFM 10152) OX=247156 GN=murG PE=3 SV=1
A0QF52	3.85e-98	2	363	32	391	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Mycobacterium avium (strain 104) OX=243243 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003135_00879.