CAZyme Information: MGYG000003125_01808

Basic Information

• Species: Corynebacterium kefirresidentii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium kefirresidentii
• CAZyme ID: MGYG000003125_01808
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	MGYG000003125_30|CGC1	87513.81	5.3152

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003125	2294743	MAG	United States	North America

• Gene Location: Start: 3283; End: 5772 Strand: -

Full Sequence      

MTVIKSLAKIALSTVLVGALIALALAPFAGISGVAIARTNETMQSDLQDLTAGNIPGVTT
IKDAKGKDMAYVFSQRRHPVEGKKISKAMKNAIVSIEDERFYDHEGVDFQGNFRALWTNL
TSGGVSQGASTIDQQYVKNYLLLVSATTDEERAAATEQSLTRKLREMRMATKMDEELDKD
DILTNYLNLVSFGNHAYGVEAAARTYFGTHASELTVPQAAMLAGMVQSSERLNPYTNAGE
VTERRNLVLQSMADNGHIKQQEADKYKGEKLGVGKKPQTLANGCIGAGDRGFYCDYVLKY
LDKKGISEEQLARGGYTIKTTLDPTVQNKALQAVQSHTNPDAPGVAEVMDVIKPGKSDRK
VLAMVSSRDYGLDLDKNETILPQPYSLVGNGAGSVFKVFTAAAALEAGYGIKNTVDVPAR
YEAEGLGHGGAAGCPADRYCVENAGAYKATMTLQEALAHSPNTPFIKLTEQVGVAPIVDM
AVRLGLRSYDDKGSFDKDTSIAQHTKEANSGSFTLGPDQVNPLELANVGATLASDGKWCE
PNPIAQITDKEGNEVYLKETPCEQAVDKDVARAMSNALSEDAKQGTAKDAAQAAGYSSPI
AAKTGTTESNQSSAFLGFNEGISAAPYIYNDGTSTVPLCTGPVRQCAGWGNLYGGLEPAQ
TFFSMASQLPIATKAGLPNYNKKYDNGTTADKTLDGLRGKSEAEARQALEAKGYVVKTSR
VIGGDVPYGRVVRAITGKDGKKKGAEITLQLSDGAGASQSPSSGVADANSTGTQNSTGGA
NTDGATSPGRSTGGTGGDGGGGGFSPEDFGIRQEDIDNFANDIRSLLGR

Enzyme Prediction     

No EC number prediction in MGYG000003125_01808.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	66	252	6.6e-67	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	5.80e-139	7	669	11	596	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.93e-119	76	635	1	506	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	9.57e-90	1	628	2	689	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	9.63e-77	66	253	2	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02071	PBP_1b	1.39e-65	92	638	162	665	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQN47759.1	0.0	1	829	1	829
QQU80865.1	0.0	1	829	1	837
QQA99133.1	0.0	1	829	1	835
QRQ67495.1	0.0	1	829	1	837
VEH71942.1	0.0	1	828	1	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U2G_A	1.12e-34	55	337	7	281	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3NB6_A	1.73e-33	62	258	5	189	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	4.37e-33	62	258	5	189	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3UDF_A	1.65e-32	79	335	41	277	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
3ZG8_B	1.33e-31	172	608	2	403	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	2.87e-48	61	633	51	573	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P70997	2.21e-45	25	636	22	587	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
A0R7G2	3.82e-45	56	628	108	649	Penicillin-binding protein 1A OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=ponA1 PE=3 SV=1
O87626	6.23e-40	60	709	51	757	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
Q8XJ01	3.81e-39	30	645	47	655	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.601908	0.389679	0.004468	0.001437	0.000609	0.001904

TMHMM  Annotations     

start	end
12	34