CAZyme Information: MGYG000003124_01069

Basic Information

• Species: Rothia mucilaginosa_A
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia mucilaginosa_A
• CAZyme ID: MGYG000003124_01069
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658	MGYG000003124_4|CGC1	72447.73	7.1442

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003124	1814262	MAG	United States	North America

• Gene Location: Start: 72692; End: 74668 Strand: -

Full Sequence      

MAEQHSDRPAPAQHPAEHDGQHEPRAVAVVVTYNRRDLLPKTLAGIASGRMRPVAVVIVD
NASTDDTAVYLDSLEYDLPVDRITLRQNMGGAGGFAVGIDRALERHNPDLVWVMDDDTEP
TENTLAEAVEAWLGYSEVPAERPAVVASRVVWTNGEDHPMNTPRTMFAAGEQRHARARAV
GARPIRSASFVSILMDAQAIRRNGGLPIAEFFIWNDDFEFSTRLIHHRDGIAVPSSVAKH
HTKTFGTTNANPGPRFYNDVRNKLWVFTRSRTLNPLEKLLYGGSSARLWVSTLLRTDDRR
TYLGYFLNGLRDGLRPPTPNRRVLEGIYPLTFPGRYGVPASNPEPVVTGNAGAAGCVSSA
PDFSVLMSVYAKENPAYLEQALESNLLNQTLRPSELVLVLDGPLTPELRAVVDRWGARAE
NLDCPPIQLVELPQNVGLAEALNAGLQACSYELVARADSDDISEPTRFAELIPALAAGGY
ALLGSAMLEVNENNSAVESVREAIVDPERLLRAMDSRNPIYHPSVAFRKSAVQTLGGYEY
VPGAEDWWLWMRLRDAGYRLGNLPAPLVRYRVGAGAYTKRGGVDAWKQDWAIQRRLYTGH
AISKARWAQNMAVRSVYRFVPESLRRNAFRALSTVAARASSTRSSSDRFTGAASEGGF

Enzyme Prediction     

No EC number prediction in MGYG000003124_01069.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	28	170	5.6e-19	0.788235294117647
GT2	364	532	4.6e-18	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04195	GT2_AmsE_like	9.84e-67	364	571	1	201	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04185	GT_2_like_b	3.10e-58	28	266	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.45e-25	23	315	2	302	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04184	GT2_RfbC_Mx_like	2.50e-17	361	572	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam00535	Glycos_transf_2	3.02e-16	29	167	3	132	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAS19389.1	0.0	1	657	1	658
ATF62567.1	0.0	1	657	1	654
QXW98740.1	0.0	1	657	1	653
BAI65128.1	0.0	1	657	6	664
QXW93103.1	7.82e-318	25	632	23	621

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48215	5.36e-41	363	597	3	229	Uncharacterized glycosyltransferase HI_1695 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1695 PE=3 SV=2
Q46635	1.52e-37	363	594	2	225	Amylovoran biosynthesis glycosyltransferase AmsE OS=Erwinia amylovora OX=552 GN=amsE PE=3 SV=2
Q03084	1.60e-35	361	625	6	263	UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase OS=Escherichia coli OX=562 GN=wbbD PE=1 SV=1
P71054	3.34e-13	357	580	1	216	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
Q4KXC9	4.28e-13	364	572	10	209	O-antigen biosynthesis glycosyltransferase WbnJ OS=Escherichia coli OX=562 GN=wbnJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003124_01069.