CAZyme Information: MGYG000003124_00399

Basic Information

• Species: Rothia mucilaginosa_A
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia mucilaginosa_A
• CAZyme ID: MGYG000003124_00399
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MGYG000003124_1|CGC7	39355.22	5.348

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003124	1814262	MAG	United States	North America

• Gene Location: Start: 455243; End: 456301 Strand: +

Full Sequence      

MPSPTVAVLVRTKDRPRFLRRALANIAEQTFTDYTVCVINDGGDESATRAILQASPLAHL
LEGDAPRLMLLTTGGGNMEAASNAGLAVTDSEFVAIHDDDDLWAPEFLERTIGALRASEA
LICSTRVVERYERETPEGEFEVYEERIFHDGLPGFGLQFLYRTNRTVPIGILYRRRLHEL
VGFYDESLPVVGDWEFNLRAAAVTEVLLVDEPLAYWSLRPEADGADANSVQRQAEHARFD
ASVRARAIRDDLQSGGRPGPYLYQAHLMADLERRVIDGHDLTRESLDLLRSLGERLERIE
ARQAAMDARQRELEARFAADRSRGRGALRTLSSAARSLARRMRSATPHGEGR

Enzyme Prediction     

No EC number prediction in MGYG000003124_00399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	8	138	3.1e-16	0.7411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06433	GT_2_WfgS_like	1.03e-14	17	218	11	195	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.30e-14	8	162	1	152	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	4.11e-14	8	178	2	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04196	GT_2_like_d	1.82e-11	7	216	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02525	Succinoglycan_BP_ExoA	1.81e-09	5	199	1	189	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAI64008.1	1.71e-172	1	298	15	306
QXW97813.1	4.31e-170	1	296	1	295
BAS20146.1	1.91e-167	1	296	15	304
VEI22149.1	1.26e-113	3	303	2	290
QXW92566.1	1.26e-113	3	303	2	290

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39614	4.66e-12	6	201	3	183	Uncharacterized glycosyltransferase YwdF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywdF PE=3 SV=1
P22639	2.22e-07	6	121	3	112	Uncharacterized glycosyltransferase alr2836 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr2836 PE=3 SV=2
P33702	2.93e-07	1	108	1	103	Succinoglycan biosynthesis protein ExoW OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoW PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003124_00399.