CAZyme Information: MGYG000003120_01071

Basic Information

• Species: Alloscardovia omnicolens
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Alloscardovia; Alloscardovia omnicolens
• CAZyme ID: MGYG000003120_01071
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		36111.17	6.8543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003120	1680436	MAG	United States	North America

• Gene Location: Start: 535; End: 1560 Strand: -

Full Sequence      

MPGRHGQPIVPLHKKMTRKHWIAASAGAVAVITLVTSTAFATVNYFNGSSSLHITAYSIN
DLVSNSKDVSRSTLRSALRNNAGDSSADTEYIKVVINGTSRMVLGSDFTDVKSVLAAGNI
TLESDDSVSPSLDTKVKESTVIKITRANSQVETVEQSVAYNTVEIEDSTLAEGTRKVTVK
GEDGVVEQTNLVTKNADGVVSTSTLTEYVKKAPVNEEVHVGTKKATASTSSGSSANLGTT
VPVSEAQSIAHEMVLARGWSESDFTALVNLWNKESGWRTTAANPSGAYGIPQALPGSKMA
SAGADWQTSATTQITWGLGYIAGRYGTPTAAWAHSQAYNWY

Enzyme Prediction     

No EC number prediction in MGYG000003120_01071.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07501	G5	2.13e-16	151	223	3	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
COG3583	YabE	7.81e-16	60	224	122	285	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam03990	DUF348	4.04e-04	92	133	1	41	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII74342.1	1.50e-109	4	341	3	342
AIC91546.1	9.80e-108	4	341	3	342
BAR04864.1	1.09e-104	1	341	1	354
AFU70977.1	1.76e-101	14	341	13	335
ATO40943.1	1.76e-101	14	341	13	335

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.308696	0.683845	0.003546	0.002221	0.000805	0.000883

TMHMM  Annotations     

start	end
21	43