CAZyme Information: MGYG000003120_00974

Basic Information

• Species: Alloscardovia omnicolens
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Alloscardovia; Alloscardovia omnicolens
• CAZyme ID: MGYG000003120_00974
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	MGYG000003120_21|CGC1	89151.3	4.6688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003120	1680436	MAG	United States	North America

• Gene Location: Start: 9394; End: 11811 Strand: +

Full Sequence      

MKFTNGYWLLRDGVSAIYAREAYELHPDTERKEVNIVATSMKVNDRANTLNLPIFDVTLS
SPAEGVIRVRSEHWSGATQYPGFPLNEEDVHNNPRVSVEAQGNGDGEAGEDGASVTLTSG
ELSARVVKGAPWNLSFEARGEELTSSAGKSLAHFALAEGAAVSAQPAGEFGVSLDGTARD
ESAVFSSIQLHLGVGEQVYGFGERFGTYIKNGQSIDIWNEDGGTASEQGYKDIPFYMTSR
GYGVLVNNRGHVSYEVGSENTEAVQFSVPGEALDFCIIYGPTPKEILERYTALTGRPSRV
PTWSYGLWLTTSFTTKYDEKTVNSFVDGMAERNIPLSAFHYDCYWMREFQWTDFEFDERF
FGTIDQVEKSLRSLHGDKGLHVCVWLNPYLGQRGSAFKEALERGYLVKKPNGEVWQTDFW
QAGMGLVDFTNPDARAWYKSKVKALLAHGVDAIKTDFGERIPRDVVWADGSPKLSMHNWY
TQLYNQTVFEALEETYGKGKACLYARSATVGGQMQPVHWGGDCESTFNGMAQSLRAGLSL
TSSGFGFWSHDIGGFEGAFPDPAVYKRWIAFGMLGSHSRLHGSTVYRVPWLFDEEDEKNG
VINAPGQSAVDVLRQFTLLKLELMPYLFELGLQPEAHGTPVMRSMFLEFPEDPTARVLDR
QYMFGSSLLVAPVFSYSGDVEYYLPAGTWTNWFTGEKAESEHGVWRKENHAFDTVPLWVC
DGSIIPTHPGATSPEYEYGKDAVLAVFGEAQVRVSEEDGSSVVFSSRVLEDGRTEVTSSD
GRDFRARLGVDGELVASTHGVAVLE

Enzyme Prediction     

EC	3.2.1.177

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	277	725	7.3e-117	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	0.0	10	761	1	709	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
PRK10658	PRK10658	0.0	1	722	1	665	putative alpha-glucosidase; Provisional
cd06593	GH31_xylosidase_YicI	8.26e-161	295	623	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
pfam01055	Glyco_hydro_31	2.52e-142	277	725	2	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	1.17e-69	195	696	81	597	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG24694.1	0.0	1	804	1	804
ADB10715.1	0.0	1	804	1	804
BAQ28021.1	0.0	1	804	1	804
AXR42366.1	0.0	1	804	1	804
AJE06671.1	0.0	1	804	1	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	7.50e-245	1	781	1	729	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	8.87e-245	1	781	1	729	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
1WE5_A	1.07e-233	2	781	2	729	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7C_A	7.90e-91	200	746	206	738	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5F7U_A	1.83e-65	81	726	147	803	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31434	3.97e-244	1	781	1	729	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q5AW25	1.47e-213	1	792	1	764	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P96793	1.01e-197	1	799	1	743	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
Q9F234	2.39e-54	196	725	147	674	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	2.05e-45	189	726	105	623	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003120_00974.