CAZyme Information: MGYG000003120_00004

Basic Information

• Species: Alloscardovia omnicolens
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Alloscardovia; Alloscardovia omnicolens
• CAZyme ID: MGYG000003120_00004
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1018		111705	8.7302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003120	1680436	MAG	United States	North America

• Gene Location: Start: 4107; End: 7163 Strand: -

Full Sequence      

MKKSSSVKLTSVLSVAVSLCLAAAPFVYAAEDVAVESTLSNSSEASTSDIPQNPSQELPE
TVAENIPDNSTMVSEDLAADSQGNMYRVETGEKITDATLVGTPDTPPDPLAKTDGEKFIP
VDIDEVKEKIEANNKQDLNKTNAAPSSVRGSRNSSVAARVRQAALPNNNYGAHWGTYNNT
PAFFESNGNLFVQQAKGVIDVSEHQGNIDWNAVKSSGNVQGVIVRLGFGSGNRLDGKAAR
NVQEIKRLRIPFGVYWYSYSASASDSVEEGKSTVAALHRLGISPQDLSYPVYYDMERWTW
TGHAPSTNPNVNADQMKAYFNTLSSAGYSNLAVYSYTSYLNTSLRHNDIWKRTTWVAQYG
ARMGFTAWNTNFRGWQYSSQGRVNGIQGNVDINAFGNHTFVGGDSAPTANVNNTGTYDVR
HYPLVRIDNGEYYINSKITEKISVDFPAATTDNGAQIKIYSYNHSQAQRFRFTRNNDDSY
TIANVKSGKVFDVNSAHAANGARVQQWDPNGSPAQRWFIRDSGYGYFLQSALGNWVLDIN
GARTHNGNIVQLYSPNLSDAQKFYLASVHGPTAGRIVKITTALNPSRVLDIAAASKQNFA
LAQTYEWNGTSAQLYTLKEVGNGTFAILNKNSNKALEVTNNRNNNGATISQYDFNNSQAQ
QWIVRRNGDGTFFFQGRGSGKFAEVPGANAFLGARLGIYEGNGTTAQRWRIAEVSQNELN
AINFARRYANDLPDGTYEFVRPTNKSVALDLAGASQANSANVQLYTANQTIAQRWIVSHD
SLGYVTLTNKASSKVLDVSGAVACNGQNMQQYQPNGTAAQKWVAVKNTDGTYTFHSKLNT
NYVVDANGNRTSNFTNVQLYTSNKSTAQKWALHDDLANGQYTFARPQNTKVVMDLNAASH
ANGANIQIYKSNRTGAQQWLVKHVDGHYVAIYNRSSGKVLDVPGAVVCNGQNIHQWQWNG
TAAQKWIAVRNNNGTYTFHSALNYSYVIDVQANSIGNFTNVHLWEENGSQAQQWNVAE

Enzyme Prediction     

No EC number prediction in MGYG000003120_00004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	199	386	2.8e-34	0.9943502824858758
CBM13	830	969	1.1e-22	0.6861702127659575
CBM13	424	520	2.9e-20	0.5
CBM13	603	719	2.2e-17	0.5957446808510638
CBM13	733	828	1.1e-16	0.48936170212765956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.18e-56	196	395	1	190	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	2.62e-26	198	395	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam14200	RicinB_lectin_2	2.73e-20	467	553	2	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	2.88e-19	916	1004	2	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	1.00e-18	772	860	2	89	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJE06636.1	9.33e-187	15	841	17	827
QRI58776.1	1.01e-177	10	789	12	784
AFL03647.1	1.01e-177	10	789	12	784
BBA48030.1	1.28e-177	50	789	1	712
BAQ29887.1	2.82e-177	50	789	73	784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	2.55e-36	193	395	266	467	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	6.23e-36	193	395	266	467	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
1JFX_A	8.05e-07	199	395	8	202	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	4.07e-06	199	411	23	228	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	8.98e-06	199	411	23	228	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	1.60e-06	199	442	12	237	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P25310	9.00e-06	199	395	85	279	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000413	0.998844	0.000256	0.000169	0.000159	0.000143

TMHMM  Annotations     

start	end
7	29