CAZyme Information: MGYG000003119_01399

Basic Information

• Species: Capnocytophaga ochracea
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Flavobacteriaceae; Capnocytophaga; Capnocytophaga ochracea
• CAZyme ID: MGYG000003119_01399
• CAZy Family: GH6
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000003119_41|CGC1	41750.63	9.5487

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003119	2451559	MAG	United States	North America

• Gene Location: Start: 20294; End: 21409 Strand: -

Full Sequence      

MKKNIILTYVYLIIAICFAIISCNKNSNTEEISQKENPKKENPKKEEPKKGNTSLLAYSK
PFYLFTETKAYEMTKQEKDPYLKKLYYQIAATPTAEWFEGVKAFDDSTLKRLIEGAKAQQ
KTPIITLYGIPYRDCGSYSTGGHKTAASYKAWINRTSAIIGKTPIIVIVEPDAHNFCLKK
GWKYNDAKYKERAELLSYVGKTFADNNPNALLYLHIGGTELKQEEAAQAVINGGIRYMRG
FVTNVADHRGTPRAEKWSEEFVQTLQKKNLGTKYYVIDTSRNGIDSPKQTNKAYYYSCNN
FNAALGVRPTTKTSAPHADAYLWIKHPGLSDGPCANGDPEAGSWYPAVAKSLVQKAIEKG
IIEEWKVPNNF

Enzyme Prediction     

No EC number prediction in MGYG000003119_01399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	70	336	4.5e-65	0.9625850340136054

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01341	Glyco_hydro_6	8.39e-46	79	339	1	292	Glycosyl hydrolases family 6.
COG5297	CelA1	2.13e-30	49	342	98	396	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLF49904.1	9.49e-262	1	371	1	371
SNV11539.1	4.51e-260	1	371	1	371
AMD84353.1	4.51e-260	1	371	1	371
ACU92078.1	1.83e-259	1	371	1	371
AVM55911.1	5.08e-258	1	371	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP3_A	1.61e-45	60	356	8	292	Structureof the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	1.61e-45	60	356	8	292	Structureof the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	1.61e-45	60	356	8	292	Structureof the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	2.74e-45	60	356	29	313	Structureof the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	2.20e-26	61	352	4	282	CRYSTALSTRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07984	2.23e-27	83	356	194	447	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
P13933	6.47e-27	88	352	106	356	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
P26414	3.57e-25	57	356	34	321	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
P26222	5.81e-25	57	352	31	313	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
P33682	2.15e-24	89	353	65	318	Endoglucanase 1 OS=Streptomyces halstedii OX=1944 GN=celA1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000017	0.002792	0.997227	0.000002	0.000003	0.000002

TMHMM  Annotations     

start	end
5	22