CAZyme Information: MGYG000003116_01343

Basic Information

• Species: Clostridium_F tepidum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F tepidum
• CAZyme ID: MGYG000003116_01343
• CAZy Family: GH113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		43123.4	9.114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003116	2461563	MAG	United States	North America

• Gene Location: Start: 309806; End: 310900 Strand: -

Full Sequence      

MKKNKFVIGIIIVFIFIYLSTLNPIIYGEINKIKNKIYGKTLNNKFEVKIKSGNLSTDYN
IDQVLKDINKFELNTINVPVVINIKDLSSSNMSVDKESEKKAIELIKKLRWKKINIILEP
YPWIDNGSLYETEWNPNDKKQFFENWRNNVIKVLIDNIAVPYHVDALNVASNFVYIEDEE
EQWCNTIDFARKYYKGLITYRTCWWYTAHWDAKTKEDYEKKLNNKLFSKIDFISVAAYFE
LIDKDTNRVEELIEAVSNVPKHDRKQNIKEELYNFNKKWNKPIFFGELGFPRKNKAASEP
WNPIPSNISNNKEQARCFEAYRRVFEKEPWILGFSIFAIGENSGDKNFYPSEETTKVIEK
WYSK

Enzyme Prediction     

No EC number prediction in MGYG000003116_01343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH113	56	343	6.4e-48	0.8758169934640523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19608	GH113_mannanase-like	1.59e-54	52	362	12	310	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
cd19606	GH113-like	5.29e-10	165	356	133	284	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EHN13856.1	5.66e-239	1	364	1	364
AKJ89329.1	5.66e-239	1	364	1	364
AJD29595.1	5.66e-239	1	364	1	364
AKC62036.1	5.66e-239	1	364	1	364
AVP59562.1	5.66e-239	1	364	1	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YLH_A	9.52e-09	86	337	56	273	Structureof GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLH_B Structure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112]
5YLI_A	5.45e-08	86	337	56	273	Complexstructure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLI_B Complex structure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLK_A Complex structure of GH 113 family beta-1,4-mannanase with mannobiose [Amphibacillus xylanus NBRC 15112],5YLK_B Complex structure of GH 113 family beta-1,4-mannanase with mannobiose [Amphibacillus xylanus NBRC 15112],5YLL_A Structure of GH113 beta-1,4-mannanase complex with M6. [Amphibacillus xylanus NBRC 15112],5YLL_B Structure of GH113 beta-1,4-mannanase complex with M6. [Amphibacillus xylanus NBRC 15112],5Z4T_A Complex structure - AxMan113A-M3 [Amphibacillus xylanus NBRC 15112],5Z4T_B Complex structure - AxMan113A-M3 [Amphibacillus xylanus NBRC 15112]
4CD6_A	5.80e-07	177	337	156	281	Thestructure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG [Alicyclobacillus acidocaldarius],4CD7_A The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG and beta-1,4-mannobiose [Alicyclobacillus acidocaldarius],4CD7_B The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG and beta-1,4-mannobiose [Alicyclobacillus acidocaldarius],4CD8_A The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManMIm [Alicyclobacillus acidocaldarius]
3CIV_A	6.29e-07	177	337	179	304	Crystalstructure of the endo-beta-1,4-mannanase from Alicyclobacillus acidocaldarius [Alicyclobacillus acidocaldarius]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.473480	0.518216	0.006713	0.000367	0.000330	0.000896

TMHMM  Annotations     

start	end
7	29