CAZyme Information: MGYG000003116_00234

Basic Information

• Species: Clostridium_F tepidum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F tepidum
• CAZyme ID: MGYG000003116_00234
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688	MGYG000003116_1|CGC3	82416.85	5.1199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003116	2461563	MAG	United States	North America

• Gene Location: Start: 254211; End: 256277 Strand: -

Full Sequence      

MPREFVEYTNDLPIKVSLQNIKKRPIHWHNAMEIIYVLEGSIKIIIETESHRVNKQEIGI
INPEEAHSIKSITNNNKVLIFQIDTNFFNKYYDIENMFFYTDFSVPEAQKHEKYDVLRKY
LSTLLCEIAQKGDNYEDVVEEILVDLLYHLINNFHYLIYDEEELKENEVQFERYDRIIKY
IYSNYNNKISIQDIARLEFLSSHYLSNEMKNKVGYSFNDFVNLTRVEEAIKLLLDTDKTI
SEISEELGFSHTRYFNKHFKKHYKCTPMQYRKKYKVDEETYEKLKVYEKLKLKDAYEYLM
HYLEDYPRFNYEGKIIKINVDLSKDTTELEENWHDIINLGSAKEILKGNHGKLIKEFQKY
VECEYAIIQNIFSKDMNVFSTEKDRFFNWYEIRQVFEFIYDLDLKPAILIDFNKYELEFF
LALFKDFIDYFTDFFGDKEIKKWRFYLKNYSEKNSSILDSFLQEYEDIEFINWDLDYKEV
NNIYDTAYMLPYILNQYLNKKSNVIFLTTFDEIYGGEYINNELFYGGSGIINRQGIKKPS
YYAYYLLSKLGNEVLEKGEGYIITKEDDDIQILVYSHSEELESLISLEDLYKRRGLKETA
EKKFSINIAALPYNYKIVTYKIDEGKGSSYNNWLAMGKPKRIDEYERDLLIQSSVPNIKL
GFAKKSPIYNIVSKIEGYGAFLFILQRV

Enzyme Prediction     

No EC number prediction in MGYG000003116_00234.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	473	641	4.4e-25	0.37354988399071926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2207	AraC	1.80e-25	154	275	2	123	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	5.64e-23	188	271	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	4.63e-21	194	273	1	81	Helix-turn-helix domain.
PRK10371	PRK10371	3.62e-13	8	272	22	291	transcriptional regulator MelR.
COG4753	YesN	1.46e-12	55	275	261	475	Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APH23944.1	0.0	1	688	1	688
APH14245.1	0.0	1	688	1	688
APQ68419.1	0.0	1	688	1	688
AUN07923.1	0.0	1	688	1	688
APC83431.1	0.0	1	688	1	688

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LSG_A	3.06e-10	200	271	31	102	Thecrystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_B The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_C The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_D The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_E The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum]
6SWI_A	4.80e-10	176	280	9	114	TheC-terminal domain of AraT, a response regulator from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
6YYH_A	5.21e-08	509	658	339	474	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]
4M29_A	1.16e-07	470	644	278	454	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	1.53e-07	470	644	278	454	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6GKK1	2.86e-20	30	660	21	714	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1
Q8NYT6	4.99e-20	30	660	21	714	Uncharacterized HTH-type transcriptional regulator MW0077 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=MW0077 PE=4 SV=1
Q6GD21	4.99e-20	30	660	21	714	Uncharacterized HTH-type transcriptional regulator SAS0078 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=SAS0078 PE=4 SV=1
Q5HJR8	1.15e-19	30	660	21	714	Uncharacterized HTH-type transcriptional regulator SACOL0084 OS=Staphylococcus aureus (strain COL) OX=93062 GN=SACOL0084 PE=4 SV=2
Q99XB1	1.52e-19	30	660	21	714	Uncharacterized HTH-type transcriptional regulator SAV0101 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=SAV0101 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003116_00234.