CAZyme Information: MGYG000003115_02662

Basic Information

• Species: Franconibacter helveticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Franconibacter; Franconibacter helveticus
• CAZyme ID: MGYG000003115_02662
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MGYG000003115_405|CGC1	27049.19	10.7741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003115	3134352	MAG	United States	North America

• Gene Location: Start: 1502; End: 2230 Strand: -

Full Sequence      

MRKGKASLWRKGWRWLWRGCAAVVALWIGGILLFGLLPVPFSAVMAERQASAWFSGDFGY
IAHSDWVGADDISPWMGLAVIAAEDQKFPEHWGFDVAAIKKAVSHNERHESRIRGASTIS
QQTAKNLFLWDGRSWLRKGLEAGLTVGIETVWSKRRILTVYLNIAEFGEGTFGVEAAAQR
YFHKPASRLSAAEAALLAAVLPNPLRFKADAPSGYVRARQAWILRQMRQLGGESFMAQHQ
LR

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	62	228	3.4e-56	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.17e-126	5	239	1	235	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.32e-77	17	233	3	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.49e-70	9	242	5	255	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.41e-58	63	228	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.13e-30	70	231	73	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPS92311.1	4.90e-140	1	241	1	241
QFH69746.1	2.83e-139	23	241	23	241
BCG07839.1	2.32e-138	1	242	1	242
AYN28701.1	6.65e-138	1	242	1	242
ATF90867.1	1.34e-137	1	242	1	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	6.77e-26	66	207	22	163	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.62e-25	66	207	22	163	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	4.90e-21	79	231	54	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
7U4H_A	6.58e-19	67	207	43	181	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3UDF_A	2.09e-18	36	231	16	206	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48465	8.95e-137	14	241	14	241	Biosynthetic peptidoglycan transglycosylase OS=Klebsiella oxytoca OX=571 GN=mtgA PE=3 SV=1
A9N776	2.56e-136	14	241	14	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) OX=1016998 GN=mtgA PE=3 SV=1
B4TWH8	3.64e-136	14	241	14	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella schwarzengrund (strain CVM19633) OX=439843 GN=mtgA PE=3 SV=1
B5R0J9	3.64e-136	14	241	14	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=mtgA PE=3 SV=1
B5RES4	3.64e-136	14	241	14	241	Biosynthetic peptidoglycan transglycosylase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999938	0.000057	0.000002	0.000000	0.000000	0.000015

TMHMM  Annotations     

start	end
21	43