CAZyme Information: MGYG000003099_01705

Basic Information

• Species: Barnesiella sp900538555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp900538555
• CAZyme ID: MGYG000003099_01705
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640	MGYG000003099_10|CGC1	73439.08	6.2315

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003099	3270064	MAG	Spain	Europe

• Gene Location: Start: 82076; End: 83998 Strand: +

Full Sequence      

MKRVQLCVAAAIFSLTAMARNVELLSPDGAYRLTFRQEKMEDGALSCRYDVEYDGMPVIT
DSRLGLELDNRIWEQALARHIERGALWMDNLELDSVSYASHAETYRPLFGERSTVENNYN
EAIAYLSKKDGSNYRMNIEMRAFNEGVAFRFYFPEHPQAIFHKVVDDFTEYTFPEGTMAW
HAAWAQAPYHKMPLQGWTQDSERALLLELPNGVYAALADADVDDWAHCKFRLSETRANTV
RNSLYGVVDMVTDFASPWHIVMAGKTPGEIVENNEIINNLNPPCAIPDAAEWVRPGKIMR
ETTLTTANAIKCIDFCAAHNMQYILFDWKWYGKADTYHTDATKIVADIDIRKVTSYAHDR
GIGVFMYVNHHAIQNQAEELFPIMKSWGVDGIKFGFVQYMSHRWSTWLHDMVRLAAKNKL
MVNIHDEYRPSGFSRTYPNLITQEGVRGNEEFPDATHNTITAFTRMINGAADYTICYYDR
RVNNTHSHQLAASLVFYSPLQTLFWYDKPDMYKGEPEVEWFEELPTVFDESHLDGKPGEY
ALSTRRHGDDWYMGLLANNDGAEHRVPLSFLAPGKKYLAKIYTDDDRVETRTHVACRYLL
VDSKSVLKLDLKPRGGVAVHFVPVDARTAKNYKKYKGQTL

Enzyme Prediction     

No EC number prediction in MGYG000003099_01705.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	12	621	1e-158	0.9920760697305864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	6.57e-57	305	525	32	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	2.41e-46	26	271	1	224	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	1.42e-28	528	622	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII66307.1	1.61e-285	19	640	22	645
QJR54190.1	1.61e-285	19	640	22	645
AND18133.1	1.61e-285	19	640	22	645
QJR61012.1	1.61e-285	19	640	22	645
QUT85427.1	1.61e-285	19	640	22	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	1.96e-57	20	619	15	652	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3WFA_A	2.89e-57	23	634	4	717	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	2.93e-57	23	634	13	726	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]
2D73_A	3.38e-57	23	634	24	737	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]
3A24_A	1.48e-56	20	619	1	638	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	1.85e-56	23	634	24	737	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	8.16e-56	1	619	1	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	5.73e-38	102	568	100	574	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000374	0.998789	0.000222	0.000213	0.000207	0.000181

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003099_01705.