CAZyme Information: MGYG000003099_01143

Basic Information

• Species: Barnesiella sp900538555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp900538555
• CAZyme ID: MGYG000003099_01143
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		37265.03	7.0733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003099	3270064	MAG	Spain	Europe

• Gene Location: Start: 119219; End: 120187 Strand: +

Full Sequence      

MKHNILYPMGCMLMLGTIVISSAFTPMRHKTVEMTDVLIPEVSLKQTFAGEEVDLSRLDM
YERYDREMTTFCYAHSLTSLIIKRANRYFPILDSILAQEGVPQDFVYLAAIESVLNPCAV
SPMKAVGMWQIMAETGRGLGLEINEFVDERYHVEKATVAACTYLKTAYEKYGHWATAAAS
YNAGMHRISQELEAQQASTSFDLWLNEETSRYVFRILCLKELMSNPSKYGYKLTEKQLYQ
PVRCHEVTVDTAIQYLPDFAIAQGITYAQLREFNPWLRTKTLPNPDGKQYVIKIPEKEAL
FLDKRDFITYRDEWIYKNKKRK

Enzyme Prediction     

No EC number prediction in MGYG000003099_01143.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	88	224	1.4e-19	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.42e-56	96	221	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	2.93e-24	73	299	93	315	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	5.39e-21	81	184	1	95	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	8.16e-14	88	217	6	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.70e-13	108	217	7	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF11673.1	1.62e-131	37	319	1	283
BCI62457.1	4.17e-122	38	314	44	320
ALJ43129.1	7.70e-106	37	315	46	324
QMW86815.1	9.70e-106	37	315	53	331
AAO79592.1	9.70e-106	37	315	53	331

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	8.66e-22	48	299	62	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	8.66e-22	48	299	62	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.427090	0.314711	0.255681	0.000476	0.000431	0.001594

TMHMM  Annotations     

start	end
5	24