CAZyme Information: MGYG000003099_00381

Basic Information

• Species: Barnesiella sp900538555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp900538555
• CAZyme ID: MGYG000003099_00381
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1133	MGYG000003099_2|CGC4	124598.9	4.7346

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003099	3270064	MAG	Spain	Europe

• Gene Location: Start: 190720; End: 194121 Strand: -

Full Sequence      

MKRLTNLFTALFLLAGMWSARAEVANPPAEFLDAPTHAADEVLAMHSSSAYTAVTGVKSV
LNTAGAKVGEVKEVAGKKLVYIENALNGWASINFTSAVDLSRYGALNLDIYVVKGAFDCK
LQFASGTSAVIITPKLAEGWNRVQVDLGDFTNSLTPPALNKIDHIDLINNGGYQRTVYID
NIYAFGKAGASLDPQMPETMAPAPTHDAAKVKSIFSDAYTNITEITNLTGTGMLKVLSVS
PTERIMKIEGGLNHWANLNFKPVNIDDRDHLHVDIFVVRESGNSTLKFRFDDGKGVTISK
VLDSGWNYLDIPLSEFKTDGSTLNAVTQFRIINNAGSQQNVFIDNLYAYGDSETGDNPEY
PTAPKESAETPEHAADKVVSLFSNAYDGAATISMLNPGVPNCDMKVIAPIKGDDMILLSG
MNWTLLKVDPAVNLEGMKFIHFDVFALGTPKINIGLGDGTNEGSCEIQYLEAGWNKLDIP
VTEFQKERGGKKGVDITKVNMIRLWSSSGFAISELYFDNIYAYDGYPGGEYYTYEIESAP
EPIMPHTTSSRLTKYVVKSLYSDKYTAMTELTASAAGEGTTVSFPLLEKGEAVIKIESLS
QVALDTRAALDLSDMEYIHVNVYRKGASGDIEIGFRSEGATEGFYSALRPELKNDGWCYV
NIPLSDLTAGGVDCSKITQILFRGTGDFYIDNIYATSGKYFLGLGEEDKISVDWAEASKA
DVLPDRNSALIGVNLASACGGATPGIVGQNYTYPTKNDIRYFKSKGARLIRFPFKWERVQ
HELNGALDMSLDVDSMKNVIGEASRLGMYVMIDMHNYCRYKVSGTEHKFGESAVLTEEAY
ADVWRKLADVFKEYDNIWGYDIMNEPYSLGEGVWMRYAQAAINAIREVDATTPIVIEGQS
YASASSWPTTGGPLIALQDPSNRLVFQAHCYFDADKSGLYKKGTFDTEVSKDTQHIDRLK
PYVTWLKEHEAEGILGEFGVPRNDARWLMMLEEVLEYLKENGVSGTYWVAGNGYASDHVS
VQPLKDFTVERAQMRVLEKYFYDYKESAIEEVKAAGEKLMTVYPNPVTDCVRIDTESAMK
RVRVLAASGSEVRSLAVNGTHAEIGLASLADGIYFVQVQMADGTIVVDKIVKR

Enzyme Prediction     

No EC number prediction in MGYG000003099_00381.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	731	1013	1.3e-80	0.975177304964539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.25e-42	741	1012	12	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	6.37e-18	752	1048	72	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam18962	Por_Secre_tail	5.35e-08	1062	1131	1	71	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
TIGR04183	Por_Secre_tail	1.59e-07	1062	1133	1	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63368.1	0.0	6	1132	355	1466
QNL39860.1	7.96e-90	716	1040	25	356
CBK67191.1	7.81e-89	724	1040	33	356
QDM10315.1	7.81e-89	724	1040	33	356
QGT72466.1	7.81e-89	724	1040	33	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4EE9_A	1.18e-68	730	1040	4	306	Crystalstructure of the RBcel1 endo-1,4-glucanase [uncultured bacterium],4M24_A Crystal structure of the endo-1,4-glucanase, RBcel1, in complex with cellobiose [uncultured bacterium]
7P6G_A	3.05e-68	730	1040	4	306	ChainA, Endoglucanase [uncultured bacterium],7P6G_B Chain B, Endoglucanase [uncultured bacterium],7P6H_A Chain A, Endoglucanase [uncultured bacterium],7P6H_B Chain B, Endoglucanase [uncultured bacterium]
6ZZ3_A	4.05e-68	730	1040	4	306	ChainA, Endoglucanase [uncultured bacterium],6ZZ3_B Chain B, Endoglucanase [uncultured bacterium],6ZZ3_C Chain C, Endoglucanase [uncultured bacterium],6ZZ3_D Chain D, Endoglucanase [uncultured bacterium]
7P6I_A	4.18e-68	730	1040	4	306	ChainA, Endoglucanase [uncultured bacterium],7P6J_A Chain A, Endoglucanase [uncultured bacterium],7P6J_B Chain B, Endoglucanase [uncultured bacterium],7P6J_C Chain C, Endoglucanase [uncultured bacterium],7P6J_D Chain D, Endoglucanase [uncultured bacterium]
5LJF_A	7.84e-68	730	1040	4	306	ChainA, Endoglucanase [uncultured bacterium],5LJF_B Chain B, Endoglucanase [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58599	1.20e-42	732	1040	119	422	Endoglucanase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=egl PE=3 SV=1
P17974	1.69e-42	678	1040	69	424	Endoglucanase OS=Ralstonia solanacearum OX=305 GN=egl PE=1 SV=2
B8MW97	5.87e-30	731	1023	34	315	probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=eglB PE=3 SV=1
Q2UPQ4	5.87e-30	731	1023	34	315	Probable endo-beta-1,4-glucanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglB PE=3 SV=1
Q1HFS8	9.69e-30	744	1040	45	326	Endo-beta-1,4-glucanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999022	0.000224	0.000178	0.000161	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003099_00381.