CAZyme Information: MGYG000003099_00073

Basic Information

• Species: Barnesiella sp900538555
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella sp900538555
• CAZyme ID: MGYG000003099_00073
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746	MGYG000003099_1|CGC1	83429.94	5.1942

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003099	3270064	MAG	Spain	Europe

• Gene Location: Start: 102179; End: 104419 Strand: -

Full Sequence      

MRRTILSIICTIVLANGWTQSPFLRDDARSWVLVDSDEFEGDTVDWSRWQSEDPRTIKHA
TYRGPENALVRDGELRLYVTKQSKNGSEWMAASIYLTEPLEYNSYVECRFKSTQCSGVNN
AFWLACRTAQGGTYNNRYEVDIVEARYNTEAGCGLGHVAWHDWKTYGYTFDADGHKFDVA
QGMHVAHDFSEYHVWGLWYGENEMIYYLDGSPVWTAKTHPKYTDQWYTGVGKADTWRPDE
EKRAYGRYGQEDWSYMGGYNGDKMNIILSTLPWGEETTPLTDAAHGTYMAVDYVRVYKPA
ELLNGRPAETICPETAEVALTGDYSLASDAGIYFSFLADDLSGDDLSVVFNDASGKAVAH
CGIDREGIYTGIGASNSHTSVAYPSKERAPFIRENGKRTLVVCRFTAKAGGFRDAMSVAV
FDYDAVPVRTEPYFYPNIDAAGNTAFTNEWTINSKAYSDASIRSLSFAGNWKISEIRVGH
NYLSVLPDSWKMPQCTLSGCHWGKKGETWQIPVELTGKSPFEIAYSYAGHDFVVSGLPAG
KIGLPVQVTRNGELAIRSVTDGDGKPARVNGRYYILTGKSRSNTETPVFDTYVQNGRDEN
FSAYQNFEMKGDARYARQLFLTFPITGLNAEDPVLLSLYCTENERNQPLVLAVDEVTENL
SRSVTWSSRPSDAECIPVSEMNVPGGTGYAVCDVSDCIRRAKSAGKARVTFRLAFADGDR
NNMVRFQQGHDSYGTNPPALMQMKFK

Enzyme Prediction     

No EC number prediction in MGYG000003099_00073.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	35	297	2.6e-20	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02178	GH16_beta_agarase	4.01e-16	26	298	14	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd00413	Glyco_hydrolase_16	4.06e-12	37	297	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	1.61e-09	36	297	2	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
NF033679	DNRLRE_dom	8.78e-06	590	740	2	161	DNRLRE domain. The DNRLRE domain, with a length of about 160 amino acids, appears typically in large, repetitive surface proteins of bacteria and archaea, sometimes repeated several times. It occurs, notably, three times in the C-terminal region of the enzyme disaggregatase from the archaeal species Methanosarcina mazei, each time with the motif DNRLRE, for which the domain is named. Archaeal proteins within this family are described particularly well by the currently more narrowly defined Pfam model, PF06848. Note that the catalytic region of disaggregatase, in the N-terminal portion of the protein, is modeled by a different HMM, PF08480.
cd02177	GH16_kappa_carrageenase	0.001	36	213	15	213	Kappa-carrageenase, member of glycosyl hydrolase family 16. Kappa-carrageenase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of kappa-carrageenans, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Carrageenans are linear chains of galactose units linked by alternating D-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Depending on the position and number of sulfate ester modifications they are subdivided into kappa-, iota-, and lambda-carrageenases, kappa being modified once. Carrageenans form thermo-reversible gels widely used for industrial applications. Kappa-carrageenases exist in bacteria belonging to at least three phylogenetically distant branches, including pseudoalteromonas, planctomycetes, and baceroidetes. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI09464.1	5.92e-118	29	488	35	519
QGY47521.1	1.08e-20	5	297	6	256
AUP79711.1	5.26e-20	3	298	7	257
AQQ10032.1	1.37e-19	23	320	1188	1429
QNN21672.1	5.90e-17	9	298	15	256

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.062774	0.647036	0.288663	0.000644	0.000428	0.000419

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003099_00073.