CAZyme Information: MGYG000003097_02884

Basic Information

• Species: Phocaeicola sp000436795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000436795
• CAZyme ID: MGYG000003097_02884
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747	MGYG000003097_44|CGC1	82089.99	6.0259

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003097	3921942	MAG	Spain	Europe

• Gene Location: Start: 14789; End: 17032 Strand: +

Full Sequence      

MKNEFMKKMALACVAGLALFSVQAQQLPVYLDGNQPIESRVEDALSRMTLQEKIAMIHAQ
SKFSSPGVPRLGIPEVWCTDGPHGIRPEVLWDEWDQAGWTNDSCVAFPALTCLAATWNPD
MALLYGKSIGEEARYRNKSILLGPGVNIYRTPLNGRNFEYMGEDPYLSSKMVVPYVRGVQ
SNGVAACVKHFALNNNEINRHTSNVIIDDRALYEIYLPAFKAAVQEGHAWSIMGSYNLYK
NQHCCHNEYLLNDILKGEWGFDGVVVSDWGGAHDTDEAISNGLDLEFGSWTNGLSNGTSN
AYDNYYLAYPYLQRIKSGKVGTAELDDKVRRVLRLIFRTTMDRNRPFGSIGSPEHFDTSR
HIAEEGIVLLQNRNNVLPLDLNKVKKVAVIGENAIKMMTVGGGSSSLKVKYEISPLDGLR
HRLAGQAEVVYARGYVGDASGEYNGVVTGQDLSDNRSAEELLAEAVEVARSCDYVIFFGG
LNKSAGQDCEDSDRQSLGLPYGQDKVIEALAKANKNLVVVNISGNAVAMPWVDEVPGIIQ
GWFLGSEAGNALAAVIVGDVNPSGRLPFTFPTSLENVGCHRLDAYPGVKRASENIWDIAY
KEGIFVGYRWSDKEKLQPLFPFGHGLSYTSFSYGKATLDRNELSASDSIHVTVLVTNTGS
VAGAEVVQLYVRDVKSSVARPVKELKGFRKIQLAPGETKLVTFTIDKSSLSYFDDKQHAW
VAEPGKFEALVAASATDIKSKVAFQLK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	68	286	7.3e-68	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.23e-132	6	740	1	759	beta-glucosidase BglX.
PLN03080	PLN03080	1.50e-73	36	706	48	743	Probable beta-xylosidase; Provisional
COG1472	BglX	4.52e-70	6	407	4	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.16e-68	367	608	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	6.57e-37	51	335	45	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89173.1	0.0	6	747	1	740
ALJ59796.1	0.0	6	747	1	740
ADV42634.1	0.0	6	747	1	740
QCQ43197.1	0.0	6	747	3	744
QMI79977.1	0.0	6	747	1	741

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.11e-160	41	741	5	663	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.64e-127	44	738	8	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	4.15e-115	41	747	6	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
2X40_A	1.12e-114	40	746	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	1.62e-113	11	739	23	821	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	1.69e-295	1	745	6	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	1.15e-159	41	741	5	663	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
P27034	3.87e-140	41	746	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q5BFG8	6.02e-135	39	747	9	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
F6C6C1	3.91e-124	48	747	12	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000306	0.998841	0.000277	0.000180	0.000191	0.000177

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003097_02884.