CAZyme Information: MGYG000003097_01496

Basic Information

• Species: Phocaeicola sp000436795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp000436795
• CAZyme ID: MGYG000003097_01496
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000003097_13|CGC2	35008.96	10.009

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003097	3921942	MAG	Spain	Europe

• Gene Location: Start: 27116; End: 28027 Strand: -

Full Sequence      

MTYAPILLFVYNRPEHTRQVVSSLLRNQEAAESPLFIYADQSKTPDNDAAVQEVRRYIHR
ISGFKSITIIERESNWGLARNIIDGVTTQVNKFGRVIVLEDDLIVAPYFLKFMNDALETY
KNEQRVGHIQACDFTKDTSLPDTFLIKWTGSWGWGTWDRAWKYFNPDGKKLLAQLEKRKL
TRYFDFNGNYPFTRMLRRQIAGQNNSWAIRWNASLFLADILSLNVGKSLIQNTGFDGSGT
NCGGGGLYDSTLWQQPLPVKLISPIEENKAVRRVFEKYYHRTNCFWAKAIRRIKRTLKGD
FGA

Enzyme Prediction     

No EC number prediction in MGYG000003097_01496.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03071	GNT-I	2.67e-07	1	126	92	225	GNT-I family. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GNT-I, GLCNAC-T I) EC:2.4.1.101 transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide. This is an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus, and is probably distributed in all tissues. The catalytic domain is located at the C-terminus.
cd02514	GT13_GLCNAC-TI	9.27e-06	4	113	2	118	GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GLCNAC-T I , GNT-I) transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide, an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus. The catalytic domain is located at the C-terminus. These proteins are members of the glycosy transferase family 13.
pfam00535	Glycos_transf_2	0.001	10	111	6	97	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36898.1	4.39e-180	3	303	2	302
ANV98023.1	5.42e-86	4	238	7	244
ATY34291.1	2.73e-84	4	272	6	273
ABZ94462.1	1.68e-83	1	242	1	243
ABZ98117.1	1.68e-83	1	242	1	243

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003097_01496.