CAZyme Information: MGYG000003093_00439

Basic Information

• Species: Collinsella sp900544845
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900544845
• CAZyme ID: MGYG000003093_00439
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720	MGYG000003093_8|CGC1	78865.34	4.8529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003093	2128385	MAG	Spain	Europe

• Gene Location: Start: 29436; End: 31598 Strand: +

Full Sequence      

MNESINELRVSRAASGAYPTISDALAATDQLYPDAEQAVTIHIDPGEYRERVEIHRPHVT
LAGETADSVRIVGSLGAKMPSEDGSGVDGTLGTFRTYTVLVDADDVRLENLTIVNDAGDG
REVGQAIALYADGDRLVVDACCITGRQDTLFLGPLPPREVKPGGFIGPKQYAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRDMDVNGYVTAASTPEGEPYGFVFHGCSFT
APDDVAPDSVYLGRPWREWAQTVLIDCWLGQHIKREGWWDWNKPAAHERARYVGASLHGP
AGDAAGWASWARELDATAAARYAREQVLAGADGWDPEGGDGDAVETASLSNSGRTVHIDI
YYEDEPALRDRLKREGRSAAFKGATPGDFEAWQIATRDRLFDLLGLSIMDRAPIEVRELD
RVQIAGGIVRTHAMLQVERDVWMPFYLLEPQTPKFDAHGCKRCYICPHGHQGAGAASVAG
VTGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDSRGWGSRRDWKGQGDDENSYLRGTCLN
QARMAEPLGLTVAGLNAWDNMRLIDYLETRGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
RKAFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLIAPRPLLVQSCEKDHLN
GARGLANVDEQLSIVRDAYGLVGHADDLLHEVCPGGHHLGVAYLAEDIEWLDGHAARARS

Enzyme Prediction     

No EC number prediction in MGYG000003093_00439.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	1.1e-81	0.9826388888888888
CE19	463	697	1.1e-25	0.5783132530120482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.95e-65	10	330	85	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.12e-48	10	330	4	297	Pectinesterase.
PLN02708	PLN02708	4.03e-42	10	336	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	1.59e-41	8	322	7	290	pectinesterase
PRK10531	PRK10531	1.98e-40	10	279	84	383	putative acyl-CoA thioester hydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	1	716	1	716
ATP54718.1	0.0	10	716	10	716
QUC03567.1	0.0	8	719	7	713
QIX89293.1	3.69e-99	8	336	17	348
ANU50094.1	4.03e-98	8	336	17	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	6.57e-27	10	300	7	267	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.46e-24	14	278	15	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.68e-24	14	278	15	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
3UW0_A	1.16e-22	33	289	55	311	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.53e-22	10	289	8	287	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	8.78e-32	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LVQ0	5.32e-30	8	314	7	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q4PT34	2.06e-28	7	278	45	286	Probable pectinesterase 56 OS=Arabidopsis thaliana OX=3702 GN=PME56 PE=2 SV=1
Q9LXD9	2.67e-28	7	314	240	527	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
O04887	4.45e-28	10	310	205	472	Pectinesterase 2 OS=Citrus sinensis OX=2711 GN=PECS-2.1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003093_00439.