CAZyme Information: MGYG000003072_04111

Basic Information

• Species: Paenibacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus amylolyticus
• CAZyme ID: MGYG000003072_04111
• CAZy Family: GH11
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
211	MGYG000003072_19|CGC3	23140.57	9.5289

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003072	7042795	MAG	China	Asia

• Gene Location: Start: 78998; End: 79633 Strand: +

Full Sequence      

MFKFSKKLLTVVLAASMSFGVFAATSSAATDYWQNWTDGGGTVNAVNGSGGNYSVNWQNT
GNFVVGKGWTYGTPNRVVNYNAGVFSPSGNGYLTFYGWTRNALIEYYVVDSWGTYRPTGT
YKGSMTSDGGTYDIYTTMRYNAPSIDGTQTFPQYWSVRQTKKPIGVNSTITFSNHVNAWA
SKGMYLGNSWSYQVMATEGYQSSGSANVTVW

Enzyme Prediction     

EC	3.2.1.8	3.1.1.72	3.1.1.6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	31	209	3.9e-70	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00457	Glyco_hydro_11	2.52e-85	31	207	3	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN74243.1	8.81e-155	1	211	1	211
APO45852.1	7.25e-154	1	211	1	211
BAE93061.1	1.03e-153	1	211	1	211
BAF49080.1	1.03e-153	1	211	1	211
ACR92577.1	1.64e-150	1	211	1	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KV0_A	3.37e-125	29	211	4	186	ChainA, Endo-1,4-beta-xylanase [Paenibacillus xylanivorans],7KV0_B Chain B, Endo-1,4-beta-xylanase [Paenibacillus xylanivorans]
1XXN_A	5.28e-115	28	211	1	185	Crystalstructure of a mesophilic xylanase A from Bacillus subtilis 1A1 [Bacillus subtilis],2DCY_A Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_B Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_C Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_D Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_E Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis]
1BVV_A	1.51e-114	28	211	1	185	ChainA, ENDO-1,4-BETA-XYLANASE [Niallia circulans],1XNB_A Chain A, XYLANASE [Niallia circulans],2B42_B Crystal structure of the Triticum xylanse inhibitor-I in complex with bacillus subtilis xylanase [Bacillus subtilis],3HD8_B Crystal structure of the Triticum aestivum xylanase inhibitor-IIA in complex with bacillus subtilis xylanase [Bacillus subtilis],3HD8_D Crystal structure of the Triticum aestivum xylanase inhibitor-IIA in complex with bacillus subtilis xylanase [Bacillus subtilis]
2QZ3_A	4.33e-114	28	211	1	185	ChainA, Endo-1,4-beta-xylanase A [Bacillus subtilis],2QZ3_B Chain B, Endo-1,4-beta-xylanase A [Bacillus subtilis],2Z79_A Chain A, Endo-1,4-beta-xylanase A [Bacillus subtilis],2Z79_B Chain B, Endo-1,4-beta-xylanase A [Bacillus subtilis]
1HV0_A	6.15e-114	28	211	1	185	ChainA, ENDO-1,4-BETA-XYLANASE [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
V9TXH2	1.89e-143	1	211	1	210	Endo-1,4-beta-xylanase Xyn11E OS=Paenibacillus barcinonensis OX=198119 GN=xyn11E PE=1 SV=1
P45705	1.71e-130	3	211	2	210	Endo-1,4-beta-xylanase A OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=3 SV=2
P18429	2.64e-121	1	211	1	213	Endo-1,4-beta-xylanase A OS=Bacillus subtilis (strain 168) OX=224308 GN=xynA PE=1 SV=1
P09850	7.57e-121	1	211	1	213	Endo-1,4-beta-xylanase OS=Niallia circulans OX=1397 GN=xlnA PE=1 SV=1
D7EZJ3	1.44e-77	32	210	67	239	Endo-1,4-beta-xylanase B OS=Streptomyces sp. OX=1931 GN=xynBS9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000197	0.999161	0.000169	0.000178	0.000157	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003072_04111.