CAZyme Information: MGYG000003070_00548

Basic Information

• Species: QALR01 sp900542425
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; QALR01; QALR01 sp900542425
• CAZyme ID: MGYG000003070_00548
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	MGYG000003070_4|CGC3	47717.03	5.3532

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003070	1834398	MAG	China	Asia

• Gene Location: Start: 61573; End: 62826 Strand: +

Full Sequence      

MKLKPKENQLKYLSWEFGIFLHFGIRTYCHGHHDWDERAMDAALFNPTELDCDQWMREIK
LAGARYAILTTKHHDGFALWPSAYTKYSVASSGWRGGKGDVVREFTDACRRAGLGCGLYY
SPAQWGGEINFSDEKAYDEYFIGQMTELLDGRYGTIDYLWLDGAFSGEHRYDTDRIVGVI
RKLQPDILIFGLDDPDVYGVGNEDGYVDTRNFYTKTICRFGKEKTSFLAAEGDCRLRDSW
FYDLNPQSIKSVDELIGMYESTVGRGANFLLNIGPNEKGLLAEEDVARLHELAAEIRKRY
LIPLPFDPVTINKDGKYEISYSKETYGMISDTVNLPLVRRVVIEEDISEGESVKEWRLIA
TIPSKYPYTDWEVCLCEGHGIGHKHICTLPAIRAPRFKLEILDHDGDYKIKSMKAFS

Enzyme Prediction     

No EC number prediction in MGYG000003070_00548.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	5	294	1.4e-75	0.8583815028901735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	2.86e-61	4	300	10	316	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.99e-50	17	294	27	326	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	1.05e-41	17	292	28	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95058.1	4.86e-129	2	416	4	414
BBH22425.1	6.66e-118	3	416	7	413
ASN07285.1	4.42e-116	1	416	1	399
QHT59657.1	1.05e-115	2	413	16	423
QHW31138.1	4.23e-113	2	407	16	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UES_A	1.88e-63	3	401	17	461	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	4.11e-62	3	401	19	463	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3EYP_A	1.73e-61	3	403	8	441	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UET_A	2.12e-61	3	401	17	461	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
5K9H_A	7.98e-61	5	416	39	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	4.02e-59	5	417	40	477	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	1.70e-58	5	293	38	337	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q2KIM0	2.89e-16	42	281	115	350	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1
Q99LJ1	6.70e-15	42	281	98	333	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
Q6AYS4	9.18e-15	16	297	46	353	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.993622	0.005987	0.000318	0.000023	0.000013	0.000042

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003070_00548.